DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and pikfyve

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001362234.2 Gene:pikfyve / 550069 XenbaseID:XB-GENE-989454 Length:2104 Species:Xenopus tropicalis


Alignment Length:350 Identity:86/350 - (24%)
Similarity:127/350 - (36%) Gaps:113/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SHFKVKEYCPLV----FRNLRE-RFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIK 143
            |....|.||.:.    |..:|: ..|..:.|:..||....|.|. ..|||||.||.:.|..||:|
 Frog  1820 SDANAKFYCRIYYAGEFHRMRKVILGSSEDDFIRSLAHCVPWQA-RGGKSGAAFYATEDDRFILK 1883

  Fly   144 SLTSEEIERMHAFLKQYHPYV---VERHGKTLLPQYLGMYRITVESVQ------YYFVVMRNVFS 199
            .:...|::....|...|..|:   |:....|.|.:.||:|||..::.|      ...:||.|:|.
 Frog  1884 QMPRLEVQSFLDFAPHYFTYIINAVQMKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFY 1948

  Fly   200 SHLTIHKKFDLKGSTVDREA---SEKE------LEKN-LPTFKDNDFIKQKVKLDIGKEAKDKLM 254
            .. .:.:.||||||..:|..   :.||      |::| |...:||       .|.|....|..|.
 Frog  1949 GR-KMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDN-------PLYIRSHCKSVLR 2005

  Fly   255 DTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSENSESEECDSGERWTYNTP 319
            .::.:|...|:...|:|||||                     |||.:.::               
 Frog  2006 ASIHSDSHFLSSHLIIDYSLL---------------------VGRDDTTD--------------- 2034

  Fly   320 PDSPRGAQYKEVVYEVDIYDIPSIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGI- 383
                      |:|                   :.|||.:..:...|:.....|:.       || 
 Frog  2035 ----------ELV-------------------VGIIDYIRTFTWDKKLEMVVKST-------GIL 2063

  Fly   384 -------STCDPEQYAKRFLDFMDK 401
                   :...||.|..||.:.|||
 Frog  2064 GGQGKMPTVVSPELYRTRFCEAMDK 2088

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 85/349 (24%)
pikfyveNP_001362234.2 FYVE_PIKfyve_Fab1 160..221 CDD:277264
DEP_PIKfyve 363..444 CDD:239895
Fab1_TCP 624..883 CDD:239450
PIPKc_PIKfyve 1824..2090 CDD:340437 84/345 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.