DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and pip5k1bb

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_005166786.1 Gene:pip5k1bb / 447840 ZFINID:ZDB-GENE-040912-141 Length:528 Species:Danio rerio


Alignment Length:371 Identity:122/371 - (32%)
Similarity:184/371 - (49%) Gaps:27/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GINHTINEL-SHVNIPVMLLPDDFRAYSKIKVDNHLFNKENMPSH----FKVKEYCPLVFRNLRE 101
            ||.:|:..| |..:..|::  .||.....:.:.:...|.  .|:|    |:.|.|.||.||..||
Zfish    36 GIGYTVGNLTSKPDRDVLM--QDFYVVESVFLPSEGSNL--TPAHHYPDFRFKTYAPLAFRYFRE 96

  Fly   102 RFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVE 166
            .||:...||..|:.:...|::.:.|.||:.||.:.|..||||::..:|.|.:...|..|: ..:.
Zfish    97 LFGIKPDDYLYSICKEPLIELSNPGASGSLFYLTSDDEFIIKTVQHKEAEFLQKLLPGYY-MNLN 160

  Fly   167 RHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTF 231
            ::.:||||::.|:|.:....:....|||.||....:.:|.|:||||||..|.||.||.||..||:
Zfish   161 QNPRTLLPKFYGLYCVQSGGINIRLVVMNNVLPRSVKMHYKYDLKGSTYKRRASRKEREKPCPTY 225

  Fly   232 KDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILT 296
            ||.||:.....|....|..:.||.||..|..:|....|||||||:|||...::..:   ||....
Zfish   226 KDLDFVDMHDGLYFDPETYNALMKTLQRDCRVLESFKIMDYSLLLGVHVLDQSHRD---GDGSAV 287

  Fly   297 VGRSENSESEECDSGERWTYNTPPDSPRG-AQYKEVVYEVD-IYDIPSIEEKRE--IYFIAIIDV 357
            .|:.        ..|::..|:|..:|.:| .:..|.:...| :..||:...:.|  :.|:.|||:
Zfish   288 DGKR--------TVGQKVLYSTAMESIQGDGKAAEALTTDDTMGGIPAKTHRDEKVLIFLGIIDI 344

  Fly   358 LTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAI 403
            |..|...|:...:.|.:.|..  |.:|...|..||.|||.||...:
Zfish   345 LQSYRFIKKLEHSWKALVYDG--DTVSVHRPSFYANRFLKFMSSRV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 122/369 (33%)
pip5k1bbXP_005166786.1 PIPKc 53..386 CDD:214623 116/350 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.