DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5K59B

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001369113.1 Gene:PIP5K59B / 37633 FlyBaseID:FBgn0034789 Length:891 Species:Drosophila melanogaster


Alignment Length:457 Identity:131/457 - (28%)
Similarity:211/457 - (46%) Gaps:95/457 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSSSQPRILKKKHFRV------KHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDF 64
            :||...:..|..|.||      .::|::    ...|:.....||.||:..|:......:|:.|.:
  Fly    49 ASSKADKERKIGHRRVGEGGEITYKKIQ----TSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFW 109

  Fly    65 RAYSKIKVDNHLFNKEN---MPSH----FKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQI 122
                  ::::..|..|.   .|:|    |:.|.|.|:.||..|:.||:...|:..|:..|...::
  Fly   110 ------EIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLREL 168

  Fly   123 DSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRI-TVES 186
            .:.|.||:.||.:.|..||||::..:|.|.:...|..|: ..:.::.:||||::.|:|.: |..:
  Fly   169 SNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYY-MNLNQNPRTLLPKFFGLYCLQTSNA 232

  Fly   187 VQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTFKDNDFIKQKVK-LDIGKEAK 250
            .....|||.|:..|.:.:|.|:||||||..|:|::.|..|..||:||.||::|... :.:..|..
  Fly   233 KNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETY 297

  Fly   251 DKLMDTLSNDVDLLTKLHIMDYSLLVGVHDC--------------VRA---------EEEALQGD 292
            ..|:.|:..|..:|....|||||||:|||:.              :||         .::.|.||
  Fly   298 AALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVALKEKQSEQRKPLRAPLAEDSDVDADDPLDGD 362

  Fly   293 NILTVGRSEN-----------------SESEECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDI 340
            ....:.|:::                 :|||..|..|        |.|.|.             |
  Fly   363 AATGISRNKSVNRQRLVAHSTAMESIQAESEPIDDEE--------DVPPGG-------------I 406

  Fly   341 PSIEEKRE--IYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDG--ISTCDPEQYAKRFLDFMDK 401
            |:..||.|  :.:|.|||:|..|.:||:.....|::.:    ||  :|.|.|..||:||.:||.|
  Fly   407 PARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIH----DGETVSVCRPSFYAQRFQNFMAK 467

  Fly   402 AI 403
            .:
  Fly   468 TV 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 124/423 (29%)
PIP5K59BNP_001369113.1 PIPKc_PIP5KI 78..473 CDD:340438 124/424 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457237
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.