DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and pip4k2ca

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_956395.2 Gene:pip4k2ca / 373124 ZFINID:ZDB-GENE-030828-9 Length:416 Species:Danio rerio


Alignment Length:423 Identity:212/423 - (50%)
Similarity:283/423 - (66%) Gaps:50/423 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSSQPRIL-------KKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDF 64
            |:|.|.::       ||:||  ..||||:|||::|:|||||||:||:||:|:.|.:|||||||||
Zfish     9 SASSPMVMLAPKTKTKKRHF--MQQKVKVFRASDPMLSVFMWGVNHSINDLNQVPVPVMLLPDDF 71

  Fly    65 RAYSKIKVDNHLFNKENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSG 129
            :|.:||||:||||||||:||||:.|||||.||||||||||::|:||:.||.||.|::.|..|:  
Zfish    72 KANTKIKVNNHLFNKENLPSHFEFKEYCPQVFRNLRERFGIEDLDYQASLARSAPMKGDGQGE-- 134

  Fly   130 AQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVM 194
            ...:.|||:..|:|.::|||:..||..|.:||.::|:.||.|||||:||||||||||...|.:||
Zfish   135 GLLFTSYDRTLIVKQISSEEVADMHNILSEYHQHIVKCHGSTLLPQFLGMYRITVESEDTYLIVM 199

  Fly   195 RNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSN 259
            ||:||..|.:|:|:|||||.||||||:||..|.||||||.||.....|:.:.:|.|:|:|:.|:.
Zfish   200 RNMFSHRLLVHRKYDLKGSLVDREASDKEKVKELPTFKDMDFRNNMQKVYVTEEQKEKMMEKLNR 264

  Fly   260 DVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSENSESEEC-------DSG-----E 312
            ||:.|.||.|||||||:|:||..|.|             |.|....|.|       ::|     :
Zfish   265 DVEFLVKLKIMDYSLLLGIHDVARGE-------------REEEEAEEPCYEDDADPENGLAPALQ 316

  Fly   313 RWTYNTPPDSPRGAQYKEVVYE---------VDIYDIPSI--EEKREIYFIAIIDVLTQYGVKKQ 366
            ..:|.|.|:...|  |...:..         :|:|.:.|.  ..:||:||:.:|||||||..||:
Zfish   317 VGSYGTSPEGIAG--YMNSIKPLGPGEFDPYIDVYAVKSAPGAPQREVYFMGLIDVLTQYDTKKK 379

  Fly   367 AAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFM 399
            ||.||||||:|:..: |||..||||||||.:|:
Zfish   380 AAHAAKTVKHGAGAE-ISTVHPEQYAKRFREFI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 198/391 (51%)
pip4k2caNP_956395.2 PIPKc 67..415 CDD:214623 180/363 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 262 1.000 Domainoid score I1902
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 431 1.000 Inparanoid score I1688
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm25941
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X950
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.