DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and fab1

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster


Alignment Length:321 Identity:76/321 - (23%)
Similarity:127/321 - (39%) Gaps:110/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DYRESLTRS--QPIQIDS-SGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV---VER 167
            |.|.:|.||  :.:|.:: .||||::|.::.|..|::|.:.|.::.....|..:|..|:   .::
  Fly  1556 DARIALARSLCKSVQWEARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQ 1620

  Fly   168 HGKTLLPQYLGMYRITVES----VQYYFVVMRNVFSSHLTIHKKFDLKGS----TVDREASEKE- 223
            ...|||.:..|::|::|:.    |:...:||.|:|.. ..|..|||||||    .||....:.| 
  Fly  1621 QQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLFYG-CNIENKFDLKGSERNRLVDPSNQQGEI 1684

  Fly   224 --LEKNLPTFKDNDFIKQKVKLDIGK------EAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHD 280
              |::||            |::...|      .:|..|.|.:..|...|.|..:||||||||   
  Fly  1685 VLLDENL------------VQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVG--- 1734

  Fly   281 CVRAEEEALQGDNILTVGRSENSESEECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDIPSIEE 345
                                                                          :::
  Fly  1735 --------------------------------------------------------------LDK 1737

  Fly   346 KREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDG-----ISTCDPEQYAKRFLDFMDK 401
            |..:..:.|||.:..:.:.|:.....|    ||.:.|     .:..:||:|.:||:|.||:
  Fly  1738 KNGVLVLGIIDYIRTFTLDKRVESIIK----GSGILGGKGKDPTVVNPERYKQRFIDAMDR 1794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 76/321 (24%)
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 76/321 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.