DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip5k1a

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_038958707.1 Gene:Pip5k1a / 365865 RGDID:1306127 Length:561 Species:Rattus norvegicus


Alignment Length:376 Identity:123/376 - (32%)
Similarity:186/376 - (49%) Gaps:40/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKEN---MPSH----FKVKEYCPLVFRNL 99
            ||.||:..||......:|:.|.:      .|::..|..|.   .|:|    |:.|.|.|:.||..
  Rat    91 GITHTVGSLSTKPERDVLMQDFY------VVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYF 149

  Fly   100 RERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV 164
            ||.||:...||..||.....|::.:||.||:.||.|.|..||||::..:|.|.:...|..|: ..
  Rat   150 RELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYY-MN 213

  Fly   165 VERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLP 229
            :.::.:||||::.|:|.:.........|||.|:....:.:|.|:||||||..|.||:||.||.||
  Rat   214 LNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLP 278

  Fly   230 TFKDNDFIKQKVK--LDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGD 292
            ||||.||: |.:.  |.:..:....|..||..|..:|....|||||||:.:|:...|:.|.:   
  Rat   279 TFKDLDFL-QDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPM--- 339

  Fly   293 NILTVGRSENSESE-----ECDSGERWTYNTPPDSPRGAQYKEVVYEVDIY--DIPSIEEKRE-- 348
                     |||::     ...:.::..|:|..:|.:|...:....|.:.:  .||:...|.|  
  Rat   340 ---------NSETQYSIDTRRPAPQKALYSTAMESIQGEARRGGTVETEDHMGGIPARNNKGERL 395

  Fly   349 IYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFM 399
            :.:|.|||:|..|...|:...:.|.:.:..  |.:|...|..||:||..||
  Rat   396 LLYIGIIDILQSYRFVKKLEHSWKALVHDG--DTVSVHRPGFYAERFQRFM 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 123/376 (33%)
Pip5k1aXP_038958707.1 PIPKc_PIP5K1A_like 79..454 CDD:340443 123/376 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.