DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and pikfyve

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_009302996.1 Gene:pikfyve / 337690 ZFINID:ZDB-GENE-030131-9636 Length:2121 Species:Danio rerio


Alignment Length:394 Identity:91/394 - (23%)
Similarity:142/394 - (36%) Gaps:122/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NHTINELSHVNIPVMLL--PDDFRAYSKIKVDNHLFNKENMPSHFKVKEYCPLV----FRNLRER 102
            ::::::||..::....|  |:......|...:.|:   |...|....|.||.:.    |..:||.
Zfish  1798 DNSMSQLSRSSVDADPLKEPESADKQKKQTGNPHI---ELQFSDANAKFYCRIYYAEEFHKMREE 1859

  Fly   103 F--GVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV- 164
            .  ..:| |:..||:.....|. ..|||||.||.:.|..||:|.:...|::....|...|..|: 
Zfish  1860 IMESTED-DFVRSLSHCVNWQA-RGGKSGAVFYATEDDRFILKQMPRLEVQSFLDFAPHYFTYIT 1922

  Fly   165 --VERHGKTLLPQYLGMYRITVESVQ------YYFVVMRNVFSSHLTIHKKFDLKGSTVDREASE 221
              |.....|.|.:.||:|||..::.|      ...:||.|:|... .:.:.||||||..:|    
Zfish  1923 GAVHLKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGR-KMAQVFDLKGSLRNR---- 1982

  Fly   222 KELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEE 286
                              .||.|.|||:    .:.:..|.:||..:|  |..|.:..| |.....
Zfish  1983 ------------------NVKTDQGKES----CEVVLLDENLLKLVH--DNPLYIRSH-CKAILR 2022

  Fly   287 EALQGDNI-----------LTVGRSENSESEECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDI 340
            .|:..|.:           |.|||.::::                         |:|        
Zfish  2023 AAIHSDALFLSSHLIIDYSLLVGRDDSTD-------------------------ELV-------- 2054

  Fly   341 PSIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGI--------STCDPEQYAKRFLD 397
                       :.|||.:..:...|:.....|:.       ||        :...||.|..||.:
Zfish  2055 -----------VGIIDYIRTFTWDKKLEMVVKST-------GILGGQGKMPTVVSPELYRTRFCE 2101

  Fly   398 FMDK 401
            .|||
Zfish  2102 AMDK 2105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 91/394 (23%)
pikfyveXP_009302996.1 FYVE_PIKfyve_Fab1 177..238 CDD:277264
DEP_PIKfyve 387..468 CDD:239895
Fab1_TCP 665..925 CDD:239450
PIPKc 1814..2108 CDD:238081 89/378 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.