DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip5k1c

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_008763323.1 Gene:Pip5k1c / 314641 RGDID:1309938 Length:692 Species:Rattus norvegicus


Alignment Length:377 Identity:122/377 - (32%)
Similarity:189/377 - (50%) Gaps:34/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKEN---MPSH----FKVKEYCPLVFRNL 99
            ||.:|:..||......:|:.|.:      .|::..|..|.   .|:|    |:.|.|.|:.||..
  Rat    86 GIGYTVGNLSSKPERDVLMQDFY------VVESIFFPSEGSNLTPAHHFQDFRFKTYAPVAFRYF 144

  Fly   100 RERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV 164
            ||.||:...||..||.....|::.:.|.||:.||.:.|..||||::..:|.|.:...|..|: ..
  Rat   145 RELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVTSDDEFIIKTVMHKEAEFLQKLLPGYY-MN 208

  Fly   165 VERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLP 229
            :.::.:||||::.|:|.:.........|||.||....:.:|.||||||||..|.||:||.||:||
  Rat   209 LNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNVLPRVVKMHLKFDLKGSTYKRRASKKEKEKSLP 273

  Fly   230 TFKDNDFIKQKVK-LDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDN 293
            |:||.||::...: |.:..:....|:.||..|..:|....|||||||:|||:..:.|.|.     
  Rat   274 TYKDLDFMQDMPEGLLLDSDTFGALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQQERER----- 333

  Fly   294 ILTVGRSENSES---EECDSGERWTYNTPPDSPRGAQYKEVVYEVD--IYDIPSIEEKRE--IYF 351
                 ::|.::|   |:....::..|:|..:|.:|...:....|.|  :..||::..:.|  :..
  Rat   334 -----QAEGAQSKADEKRPVAQKALYSTAMESIQGGAARGEAIETDDTMGGIPAVNGRGERLLLH 393

  Fly   352 IAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAI 403
            |.|||:|..|...|:.....|.:.:..  |.:|...|..||:||..||...:
  Rat   394 IGIIDILQSYRFIKKLEHTWKALVHDG--DTVSVHRPSFYAERFFKFMSSTV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 122/375 (33%)
Pip5k1cXP_008763323.1 PIPKc 103..443 CDD:214623 117/358 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.