DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and its3

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_594429.1 Gene:its3 / 2542231 PomBaseID:SPAC19G12.14 Length:742 Species:Schizosaccharomyces pombe


Alignment Length:454 Identity:134/454 - (29%)
Similarity:219/454 - (48%) Gaps:71/454 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISSSSQPRILKKKHFRVKHQKVKLFRANEPILSVFMWGINH-----TINELSHVNIPVM------ 58
            |.|:|....:|:|...::.::.:|  .:|.:|........|     ..|.|:.:.:.|.      
pombe   227 IGSASWAEAVKQKRVNMRRRREEL--DDECVLVGTRVSEGHENYVTAYNMLTGIRVGVSRCQAKM 289

  Fly    59 ---LLPDDFRAYSKIKVDNHLFNKENMPS---HFKVKEYCPLVFRNLRERFGVDDVDYRESLTRS 117
               |.|.||.|..|...|  :...|..||   .||.|:|.|.|||:||:.|.:|..||..|||..
pombe   290 DRELTPADFTARHKFTFD--ITGNELTPSAKYDFKFKDYAPWVFRHLRQLFHLDAADYLVSLTSK 352

  Fly   118 QPI-QIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYR 181
            ..: ::||.||||:.||.|.|..||||::...|.:.:...|..|:.: |:.:..||:.|:.|::|
pombe   353 YILSELDSPGKSGSFFYFSRDYRFIIKTIHHSEHKFLREILYDYYEH-VKNNPNTLISQFYGLHR 416

  Fly   182 ITVE-SVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKE-LEKNLPTFKDNDFIKQKVKLD 244
            :.:. ..:.:||||.|:|..|..||:.|||||||:.||..|.: .:..:.|.||.::|::.:.|.
pombe   417 VKLPFGRKIHFVVMNNLFPPHRDIHQTFDLKGSTLGRELDENQPCQSPMCTMKDTNWIRRNMHLQ 481

  Fly   245 IGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTV------------ 297
            .|...:...:..:..|:|:|:.|.|||||||||:||..|...:.:: ::||:|            
pombe   482 FGPLKRQIFLTQVKADIDMLSSLGIMDYSLLVGIHDLSRGNRDKIR-NSILSVYDPNVSQHRVPS 545

  Fly   298 --GRSENSE----------------SEECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDIPSIE 344
              |...:|.                .:.|:.       .|.|  :..:.:..::..|.....:.:
pombe   546 INGNESHSNVHVIRQVVNSTGPVSLDQSCNL-------LPTD--QFVERRNFMFYSDDGGFQATD 601

  Fly   345 EKRE----IYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAIE 404
            |..|    |::|.|||:||:|...|:.....|.:.:..:|  ||...|.:||.||..|::.:|:
pombe   602 ENNEPGNFIFYIGIIDLLTKYSYVKRVEHLWKGINHSDSV--ISAVPPAEYASRFYKFVESSIK 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 127/424 (30%)
its3NP_594429.1 MSS4 1..667 CDD:227578 134/454 (30%)
PIPKc 294..662 CDD:214623 120/382 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.