DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip5kl1

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_017172887.1 Gene:Pip5kl1 / 227733 MGIID:2448520 Length:568 Species:Mus musculus


Alignment Length:316 Identity:74/316 - (23%)
Similarity:142/316 - (44%) Gaps:70/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKISSSSQPRILKKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDFRAY 67
            |.|||.|:..:|  .|.|.:..:|.||..          |..|.::.::.      ::.:...|.
Mouse   269 KSISSGSRRGLL--WHLRARQSRVGLFEV----------GPGHELHRMTR------MMQEGLWAA 315

  Fly    68 SKIKVDNHLFNKENMPS---------------H---FKVKEYCPLVFRNLRERFGVDDVDYRESL 114
            :::       :|.|.|:               |   |::.......|..||:..|:.:.||:.:|
Mouse   316 TQV-------SKNNPPTGPTTQKDYLEVMTQVHEEGFELGTLAGPAFARLRKSIGLTEEDYQATL 373

  Fly   115 TRSQP-IQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLG 178
            ....| :|..|:.||.|.|:.::|:.|.:|:....|:..:.|.|.:|..: ::::..:||.:.||
Mouse   374 GPGDPYLQFFSTSKSKASFFLTHDQRFFVKTQRRHEVHVLLAHLPRYVEH-LQQYPHSLLARLLG 437

  Fly   179 MYRITV-ESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDR------EASEKELEKNLPTFKDNDF 236
            :|.:.| :..:.||::|:.:|.....|.:::|:||..:.|      |.|...|     ..||.:|
Mouse   438 VYSLRVAQGKKKYFIIMQCIFYPTSRISERYDIKGCNISRWVDPAPEGSPLVL-----VLKDLNF 497

  Fly   237 IKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLV----------GVHDCV 282
              |:..:.:|.: :...:..:..|...|.:::::||||||          |:|..|
Mouse   498 --QEKTMRLGAQ-RSWFLRQMELDTAFLREVNVLDYSLLVAIQFLHEDEKGIHHSV 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 63/287 (22%)
Pip5kl1XP_017172887.1 PIPKc 299..>543 CDD:391950 59/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.