DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIKFYVE

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_011509080.1 Gene:PIKFYVE / 200576 HGNCID:23785 Length:2110 Species:Homo sapiens


Alignment Length:350 Identity:90/350 - (25%)
Similarity:127/350 - (36%) Gaps:113/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SHFKVKEYCPLV----FRNLRE-RFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIK 143
            |....|.||.|.    |..:|| .....:.|:..||:.|.|.|. ..|||||.||.:.|..||:|
Human  1826 SDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQA-RGGKSGAAFYATEDDRFILK 1889

  Fly   144 SLTSEEIERMHAFLKQYHPYV---VERHGKTLLPQYLGMYRITVESVQ------YYFVVMRNVFS 199
            .:...|::....|...|..|:   |::...|.|.:.||:|||..::.|      ...:||.|:|.
Human  1890 QMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFY 1954

  Fly   200 SHLTIHKKFDLKGSTVDREA---SEKE------LEKN-LPTFKDNDFIKQKVKLDIGKEAKDKLM 254
            .. .:.:.||||||..:|..   :.||      |::| |...:||       .|.|...:|..|.
Human  1955 GR-KMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDN-------PLYIRSHSKAVLR 2011

  Fly   255 DTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSENSESEECDSGERWTYNTP 319
            .::.:|...|:...|:|||||||..|.          .|.|.||                     
Human  2012 TSIHSDSHFLSSHLIIDYSLLVGRDDT----------SNELVVG--------------------- 2045

  Fly   320 PDSPRGAQYKEVVYEVDIYDIPSIEEKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGI- 383
                                              |||.:..:...|:.....|:.       || 
Human  2046 ----------------------------------IIDYIRTFTWDKKLEMVVKST-------GIL 2069

  Fly   384 -------STCDPEQYAKRFLDFMDK 401
                   :...||.|..||.:.|||
Human  2070 GGQGKMPTVVSPELYRTRFCEAMDK 2094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 89/349 (26%)
PIKFYVEXP_011509080.1 FYVE_PIKfyve_Fab1 166..227 CDD:277264
DEP_PIKfyve 369..450 CDD:239895
Fab1_TCP 629..889 CDD:239450
PIPKc 1784..2097 CDD:238081 89/349 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.