DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip5k1b

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_032872.1 Gene:Pip5k1b / 18719 MGIID:107930 Length:539 Species:Mus musculus


Alignment Length:405 Identity:126/405 - (31%)
Similarity:192/405 - (47%) Gaps:46/405 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KHQKVKLFR--ANEPILSVFMWGINHTINELSHVNIPVM-LLPDDFRAYSKIKVDNHLFNKENMP 83
            |..:.|.::  |:..|......||.:|:..|:  :.|.. :|..||.....:.:.:...|.  .|
Mouse    14 KQNEEKTYKKTASSAIKGAIQLGIGYTVGNLT--SKPERDVLMQDFYVVESVFLPSEGSNL--TP 74

  Fly    84 SH----FKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKS 144
            :|    |:.|.|.||.||..||.||:...||..|:.....|::.:.|.||:.|:.:.|..||||:
Mouse    75 AHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFLTSDDEFIIKT 139

  Fly   145 LTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFD 209
            :..:|.|.:...|..|: ..:.::.:||||::.|:|.:....:....|||.||....:.:|..:|
Mouse   140 VQHKEAEFLQKLLPGYY-MNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRAMRMHLTYD 203

  Fly   210 LKGSTVDREASEKELEKNLPTFKDNDFIKQKVK-LDIGKEAKDKLMDTLSNDVDLLTKLHIMDYS 273
            |||||..|.||.||.||..|||||.||::...: |....|..:.||.||..|..:|....|||||
Mouse   204 LKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYS 268

  Fly   274 LLVGV----HDCVRAEEEALQGDNILTVGRSENSESEECDSGERWTYNTPPDSPRG--------- 325
            ||:|:    |.....|||.||           |....:....::..|:|..:|.:|         
Mouse   269 LLLGIHILDHSLKDKEEEPLQ-----------NVPDAKRPGMQKVLYSTAMESIQGPGKSADGII 322

  Fly   326 AQYKEVVYEVDIYDIPSIEEKRE--IYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDP 388
            |:..:.     :..||:...|.|  :.|:.|||:|..|.:.|:...:.|.:.|..  |.:|...|
Mouse   323 AENPDT-----MGGIPAKSHKGEKLLLFMGIIDILQSYRLMKKLEHSWKALVYDG--DTVSVHRP 380

  Fly   389 EQYAKRFLDFMDKAI 403
            ..||.|||.||:..:
Mouse   381 SFYADRFLKFMNSRV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 123/391 (31%)
Pip5k1bNP_032872.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 2/6 (33%)
PIPKc_PIP5K1B 27..400 CDD:340444 123/392 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.