DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip5k1c

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001280575.1 Gene:Pip5k1c / 18717 MGIID:1298224 Length:687 Species:Mus musculus


Alignment Length:377 Identity:122/377 - (32%)
Similarity:189/377 - (50%) Gaps:34/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKEN---MPSH----FKVKEYCPLVFRNL 99
            ||.:|:..||......:|:.|.:      .|::..|..|.   .|:|    |:.|.|.|:.||..
Mouse    86 GIGYTVGNLSSKPERDVLMQDFY------VVESIFFPSEGSNLTPAHHFQDFRFKTYAPVAFRYF 144

  Fly   100 RERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV 164
            ||.||:...||..||.....|::.:.|.||:.||.:.|..||||::..:|.|.:...|..|: ..
Mouse   145 RELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVTSDDEFIIKTVMHKEAEFLQKLLPGYY-MN 208

  Fly   165 VERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLP 229
            :.::.:||||::.|:|.:.........|||.||....:.:|.||||||||..|.||:||.||:||
Mouse   209 LNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNVLPRVVKMHLKFDLKGSTYKRRASKKEKEKSLP 273

  Fly   230 TFKDNDFIKQKVK-LDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDN 293
            |:||.||::...: |.:..:....|:.||..|..:|....|||||||:|||:..:.|.|.     
Mouse   274 TYKDLDFMQDMPEGLLLDSDTFGALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQQERER----- 333

  Fly   294 ILTVGRSENSES---EECDSGERWTYNTPPDSPRGAQYKEVVYEVD--IYDIPSIEEKRE--IYF 351
                 ::|.::|   |:....::..|:|..:|.:|...:....|.|  :..||::..:.|  :..
Mouse   334 -----QAEGAQSKADEKRPVAQKALYSTAMESIQGGAARGEAIETDDTMGGIPAVNGRGERLLLH 393

  Fly   352 IAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRFLDFMDKAI 403
            |.|||:|..|...|:.....|.:.:..  |.:|...|..||:||..||...:
Mouse   394 IGIIDILQSYRFIKKLEHTWKALVHDG--DTVSVHRPSFYAERFFKFMSSTV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 122/375 (33%)
Pip5k1cNP_001280575.1 PIPKc 103..443 CDD:214623 117/358 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.