DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and ppk-3

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_510155.3 Gene:ppk-3 / 181428 WormBaseID:WBGene00004089 Length:1497 Species:Caenorhabditis elegans


Alignment Length:430 Identity:102/430 - (23%)
Similarity:158/430 - (36%) Gaps:139/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPD--DFRAYSKIKVDNHLFNK------ 79
            |..:||    :|.|.|.:..|..|.....         ||  ...||:...||   :||      
 Worm  1136 HLAIKL----QPRLGVVVRDIQDTRGNFK---------PDIGSIIAYALSAVD---YNKIPEAAD 1184

  Fly    80 -------------------ENMPS--HFKVK-------EYCPLV----FRNLRERFGVD-DVDYR 111
                               ||:.|  |.:|:       .|..::    ||.|||....: :..:.
 Worm  1185 TVSMDSASSSLKFSQMDDGENLASSQHLEVEFEDESASYYVKMLYAEKFRKLRELLIAEGEETFI 1249

  Fly   112 ESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYV----VERHGKTL 172
            .||:.| .......||||:.||::.|..|::|.::..||:....|...|..|:    .|....||
 Worm  1250 RSLSNS-TFWTPQGGKSGSFFYRTQDDRFVVKQMSRFEIQSFVKFAPNYFDYLTTSATESKLTTL 1313

  Fly   173 LPQYLGMYRITVES----VQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTFKD 233
            ...| |::||..:|    ::...:||..:|.:| .:.:.:|||||..:|.||..: ..|.....|
 Worm  1314 CKVY-GVFRIGYKSKTTTLKVDILVMEYLFYNH-NVSQVWDLKGSLRNRLASTGK-SANEMVLLD 1375

  Fly   234 NDFIKQ--KVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILT 296
            .:|:|.  ..:|.:...:|..:...:|||...|:..:||||||||||.|                
 Worm  1376 ENFVKDLWNQQLYVLPHSKAAMNQAISNDSHFLSSQYIMDYSLLVGVDD---------------- 1424

  Fly   297 VGRSENSESEECDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDIPSIEEKREIYFIAIIDVLTQY 361
                        |:||                                     ..:.|:|.:..|
 Worm  1425 ------------DNGE-------------------------------------LILGIVDYMRTY 1440

  Fly   362 GVKKQAAKAAKTVKY-GSNVDGISTCDPEQYAKRFLDFMD 400
            .:.|:.....|.|.. |:::..|  ..||.|..||.:.:|
 Worm  1441 TLDKKLESWVKIVAIPGAHLPTI--LSPEMYCARFSEAID 1478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 99/421 (24%)
ppk-3NP_510155.3 FYVE_PIKfyve_Fab1 106..167 CDD:277264
Fab1_TCP 378..642 CDD:239450
PIPKc 1164..1482 CDD:238081 92/389 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.