DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and PIP5KL1

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001128691.1 Gene:PIP5KL1 / 138429 HGNCID:28711 Length:394 Species:Homo sapiens


Alignment Length:357 Identity:97/357 - (27%)
Similarity:172/357 - (48%) Gaps:58/357 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DDFRAYSKIKVDNHLFNKENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQP-IQIDSS 125
            |||   |::....|        ..|::.......|..||...|:.:.||:.:|....| :|..|:
Human    82 DDF---SEVLTQVH--------EGFELGTLAGPAFAWLRRSLGLAEEDYQAALGPGGPYLQFLST 135

  Fly   126 GKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVE-SVQY 189
            .||.|.|:.|:|:.|.:|:....|::.:.|.|.:|..: ::||..:||.:.||::.:.|: ..:.
Human   136 SKSKASFFLSHDQRFFLKTQGRREVQALLAHLPRYVQH-LQRHPHSLLARLLGVHSLRVDRGKKT 199

  Fly   190 YFVVMRNVFSSHLTIHKKFDLKGSTVDR------EASEKELEKNLPTFKDNDFIKQKVKLDIGKE 248
            ||:||::||.....|.:::|:||..|.|      |.|...|     ..||.:|  |...:::|.:
Human   200 YFIVMQSVFYPAGRISERYDIKGCEVSRWVDPAPEGSPLVL-----VLKDLNF--QGKTINLGPQ 257

  Fly   249 AKDKLMDTLSNDVDLLTKLHIMDYSLLVG---VHDCVRAEEEALQGDNIL--TVGRSENSES-EE 307
             :...:..:..|...|.:|:::|||||:.   :|     |:|...|.:::  |....:.::| ||
Human   258 -RSWFLRQMELDTTFLRELNVLDYSLLIAFQRLH-----EDERGPGSSLIFRTARSVQGAQSPEE 316

  Fly   308 CDSGERWTYNTPPDSPRGAQYKEVVYEVDIYDIPSIEEKREIYFIAIIDVLTQYGVKKQAAKAAK 372
            ..:..|   ...||:|..         :.|.|.|   |:|  ||:.::|:.|.||::|:.....|
Human   317 SRAQNR---RLLPDAPNA---------LHILDGP---EQR--YFLGVVDLATVYGLRKRLEHLWK 364

  Fly   373 TVKYGSNVDGISTCDPEQYAKRFLDFMDKAIE 404
            |::|....  .||..|.:||:|...:::...|
Human   365 TLRYPGRT--FSTVSPARYARRLCQWVEAHTE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 96/354 (27%)
PIP5KL1NP_001128691.1 PIP5K 128..392 CDD:279801 83/296 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.