DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip4k2c

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_011241590.1 Gene:Pip4k2c / 117150 MGIID:2152214 Length:484 Species:Mus musculus


Alignment Length:348 Identity:175/348 - (50%)
Similarity:232/348 - (66%) Gaps:22/348 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 INELSHVNIPVMLLPDDFRAYSKIKVDNHLFNKENMPSHFKVKEYCPLVFRNLRERFGVDDVDYR 111
            |||||.|..|||||||||:|.|||||:||.|::||:|||||.|||||.||||||:||.:||.||.
Mouse   117 INELSQVPPPVMLLPDDFKASSKIKVNNHFFHRENLPSHFKFKEYCPQVFRNLRDRFAIDDHDYL 181

  Fly   112 ESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQY 176
            .|||||.|.:.:.   |..:|..|||:..:||.::||:|..||:.|..||.|:|:.||.|||||:
Mouse   182 VSLTRSPPSETEG---SDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQF 243

  Fly   177 LGMYRITVESVQYYFVVMRNVFSSHLTIHKKFDLKGSTVDREASEKELEKNLPTFKDNDFIKQKV 241
            |||||::||:...|.:||||:||..|.:|:|:|||||.|.||||:||..|.|||.||.||:.:..
Mouse   244 LGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQ 308

  Fly   242 KLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSENSESE 306
            |:.||:|.|...::.|..||:.|.:|.|||||||:|:||.:|..|...:|.     .|.|.||.:
Mouse   309 KVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEGP-----VREEESEWD 368

  Fly   307 -ECD-SGER---WTYNTPPDSPRGAQYK-------EVVYEVDIYDIPSIE--EKREIYFIAIIDV 357
             :|: :|..   .:|.|.|:...|..:.       |....:|:|.|.|.|  .::|:||:.:||:
Mouse   369 GDCNLAGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDI 433

  Fly   358 LTQYGVKKQAAKAAKTVKYGSNV 380
            ||||..||:||.||||||:|..|
Mouse   434 LTQYDAKKKAAHAAKTVKHGVRV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 175/348 (50%)
Pip4k2cXP_011241590.1 PIPKc 117..349 CDD:391950 135/234 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 281 1.000 Domainoid score I1661
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 455 1.000 Inparanoid score I1579
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm43587
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.