DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip4k2a

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_446378.1 Gene:Pip4k2a / 116723 RGDID:621708 Length:406 Species:Rattus norvegicus


Alignment Length:394 Identity:226/394 - (57%)
Similarity:287/394 - (72%) Gaps:20/394 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNK 79
            |||||..  ||||||||::|:|||.|||:||:|||||||.|||||:||||:||||||||||||||
  Rat    19 KKKHFVA--QKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYSKIKVDNHLFNK 81

  Fly    80 ENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKS 144
            ||||||||.|||||:||||||||||:||.|::.|||||.|:..||..:|||:|:.||||.::||:
  Rat    82 ENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYVIKT 146

  Fly   145 LTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFD 209
            :|||::..||..||:||.|:||.||.|||||:|||||:.|:.|:.|.:|.|||||..|::::|:|
  Rat   147 ITSEDVAEMHNILKKYHQYIVECHGVTLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKYD 211

  Fly   210 LKGSTVDREASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSL 274
            ||||||.||||:||..|.|||.||||||.:..|:.|....|...::.|..||:.|.:|.:|||||
  Rat   212 LKGSTVAREASDKEKAKELPTLKDNDFINEGQKIYIDDSNKKIFLEKLKKDVEFLAQLKLMDYSL 276

  Fly   275 LVGVHDCVRAEEEALQGDNILTVGRSENSESEECDSGERWTYNTPPDSPRGAQYK-------EVV 332
            |||:||..|||:|.::.:        ||...||.:|.......||||||......       |..
  Rat   277 LVGIHDVERAEQEEVECE--------ENEGEEEGESDGAHPIGTPPDSPGNTLNSSPPLAPGEFD 333

  Fly   333 YEVDIYDIPSIEE--KREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQYAKRF 395
            ..:|:|.|...|.  ::|:||:||||:||.|..||:||.||||||:|:..: |||.:||||:|||
  Rat   334 PNIDVYAIKCHENAPRKEVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAE-ISTVNPEQYSKRF 397

  Fly   396 LDFM 399
            |||:
  Rat   398 LDFI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 213/377 (56%)
Pip4k2aNP_446378.1 PIPKc_PIP5K2A 27..403 CDD:340446 220/384 (57%)
Required for interaction with PIP5K1A. /evidence=ECO:0000250|UniProtKB:Q8TBX8 59..65 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..328 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 281 1.000 Domainoid score I1597
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 455 1.000 Inparanoid score I1537
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm45659
orthoMCL 1 0.900 - - OOG6_104901
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X950
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.