DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and Pip4k2b

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_473392.1 Gene:Pip4k2b / 108083 MGIID:1934234 Length:416 Species:Mus musculus


Alignment Length:403 Identity:232/403 - (57%)
Similarity:297/403 - (73%) Gaps:25/403 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNK 79
            |||||..  ||||||||:||||||.|||:||||||||:|.:||||:||||:||||||||||||||
Mouse    24 KKKHFVC--QKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSKIKVDNHLFNK 86

  Fly    80 ENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKS 144
            ||:||.||.|||||:||||||||||:||.||:.|:|||.||..||.|:.|.:|..:||:.|:||:
Mouse    87 ENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKT 151

  Fly   145 LTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFD 209
            ::||::..||..||:||.::||.||.|||||:|||||:||:.|:.|.||.|||||..||:|:|:|
Mouse   152 VSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYD 216

  Fly   210 LKGSTVDREASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSL 274
            ||||||.||||:||..|:|||||||||:.:..||.:|:|:|...::.|..||:.|.:|.||||||
Mouse   217 LKGSTVAREASDKEKAKDLPTFKDNDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSL 281

  Fly   275 LVGVHDCVRAEEEALQGDNILTVGRSENSESEECDS-----GERWTYNTPPDS-------PRGAQ 327
            |||:||..|||:|.::.:        |.:|.|||::     ....:|.|||||       ||...
Mouse   282 LVGIHDVDRAEQEEMEVE--------ERAEEEECENDGVGGSLLCSYGTPPDSPGNLLSFPRFFG 338

  Fly   328 YKEVVYEVDIYDIPSIEE--KREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDGISTCDPEQ 390
            ..|....||:|.:.|.|.  |:|:||:||||:||.|..||:||.||||||:|:..: |||.:|||
Mouse   339 PGEFDPSVDVYAMKSHESAPKKEVYFMAIIDILTPYDAKKKAAHAAKTVKHGAGAE-ISTVNPEQ 402

  Fly   391 YAKRFLDFMDKAI 403
            |:|||.:||...:
Mouse   403 YSKRFNEFMSNIL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 219/384 (57%)
Pip4k2bNP_473392.1 PIPKc_PIP5K2B 30..413 CDD:340447 227/393 (58%)
Required for interaction with PIP5K1A. /evidence=ECO:0000250|UniProtKB:Q8TBX8 64..70 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 281 1.000 Domainoid score I1661
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2634
Inparanoid 1 1.050 455 1.000 Inparanoid score I1579
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm43587
orthoMCL 1 0.900 - - OOG6_104901
Panther 1 1.100 - - LDO PTHR23086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 1 1.000 - - X950
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.870

Return to query results.
Submit another query.