DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K and pip4k2b

DIOPT Version :9

Sequence 1:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_002940195.1 Gene:pip4k2b / 100380045 XenbaseID:XB-GENE-979374 Length:418 Species:Xenopus tropicalis


Alignment Length:411 Identity:232/411 - (56%)
Similarity:304/411 - (73%) Gaps:24/411 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISSSSQPRILKKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDFRAYSK 69
            |.|:|:.: .|||||..  ||||||||:||:|||.|||:||||||||:|.:||||:||||:||||
 Frog    19 IGSASKTK-TKKKHFVC--QKVKLFRASEPLLSVLMWGVNHTINELSNVPVPVMLMPDDFKAYSK 80

  Fly    70 IKVDNHLFNKENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQ 134
            ||||||||||||:||.||.|||||:||||||||||:||.||:.|||||.|:..::.|:.|::|..
 Frog    81 IKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSLTRSAPVNSENQGRFGSRFLT 145

  Fly   135 SYDKFFIIKSLTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFS 199
            :||:.|:||:::||::..||..||:||.::||.||.|||||:|||||:||:.|:.|.||.|||||
 Frog   146 TYDRRFVIKTISSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFS 210

  Fly   200 SHLTIHKKFDLKGSTVDREASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLL 264
            ..|.:|:|:|||||||.||||:||..|:|||||||||:.:..||.:|:|.|...::.|..||:.|
 Frog   211 HRLGVHRKYDLKGSTVSREASDKEKAKDLPTFKDNDFLNEGQKLHVGEENKKIFLEKLKRDVEFL 275

  Fly   265 TKLHIMDYSLLVGVHDCVRAEEEALQGDNILTVGRSENSESEECD--SGER-WTYNTPPDS---- 322
            :.|.|||||||||:||..|||:|.::.:        |.:|.|||:  ||.. .:|.|||||    
 Frog   276 SVLKIMDYSLLVGLHDVDRAEQEEMEVE--------ERAEEEECEDSSGNPICSYGTPPDSPGNL 332

  Fly   323 ---PRGAQYKEVVYEVDIYDIPSIEE--KREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSNVDG 382
               ||.....|....||:|.:.|.:.  |:|:||:||||:||.|..||:||.||||||:|:..: 
 Frog   333 LNFPRFFGPGEFDPSVDVYAMKSHDSAPKKEVYFMAIIDILTPYDAKKKAAHAAKTVKHGAGAE- 396

  Fly   383 ISTCDPEQYAKRFLDFMDKAI 403
            |||.:||||:|||::||...:
 Frog   397 ISTVNPEQYSKRFIEFMSNIL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 216/382 (57%)
pip4k2bXP_002940195.1 PIPKc_PIP5K2B 34..415 CDD:340447 224/391 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1689
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2634
Inparanoid 1 1.050 451 1.000 Inparanoid score I1571
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm48747
Panther 1 1.100 - - LDO PTHR23086
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2198
SonicParanoid 1 1.000 - - X950
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.