DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14838 and DYNC2I1

DIOPT Version :9

Sequence 1:NP_648138.1 Gene:CG14838 / 38851 FlyBaseID:FBgn0035799 Length:1132 Species:Drosophila melanogaster
Sequence 2:XP_006716104.1 Gene:DYNC2I1 / 55112 HGNCID:21862 Length:1069 Species:Homo sapiens


Alignment Length:342 Identity:68/342 - (19%)
Similarity:124/342 - (36%) Gaps:92/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   854 KEERRKMGIQSWEQKY----------------YELNKDIIEAKREAAAEIRKEMEKKEKEEQLAS 902
            |:|..:.|.:..|::|                |.|.|:..|.:.....|..::.:.:||......
Human   172 KDEDSERGDEDRERRYRERKLQYGDSKDNPLKYWLYKEEGERRHRKPREPDRDNKHREKSSTREK 236

  Fly   903 RKK--GQKSGEDGGEGGEEIKGKKNYSGLNYNEKMAVKWDELNLNRMMTILMSRKQMDPEKLARE 965
            |:|  .:||.....:|.|..|.|::..|.:::::.    .:.|::|      ..|....|...||
Human   237 REKYSKEKSNSFSDKGEERHKEKRHKEGFHFDDER----HQSNVDR------KEKSAKDEPRKRE 291

  Fly   966 TALEKERHAYEAAKK----KSHLDILATVENDIANIRSR----------------ILPLELQDMQ 1010
            :...:.|:...::|:    ..|.:.|  |.|...:..||                ..|...:.:.
Human   292 SQNGEHRNRGASSKRDGTSSQHAENL--VRNHGKDKDSRRKHGHEEGSSVWWKLDQRPGGEETVV 354

  Fly  1011 RSEMIAERVKREVENADSYEKVCEDAFEMLNNFKEFEPID--------------YIEFLERGRKR 1061
            |.|:..|....|...||:|...|||.||...:  :||..|              .:|.|...:|:
Human   355 RREIEKEETDLENARADAYTASCEDDFEDYED--DFEVCDGDDDESSNEPESREKLEELPLAQKK 417

  Fly  1062 R-QLLDQSLGGNTDR-----LRWYEERVRLGELGECQFIYEPISGSQGEES-------------- 1106
            . |.:.:::....:|     |:.:::|      |..:|..||.:.:....|              
Human   418 EIQEIQRAINAENERIGELSLKLFQKR------GRTEFEKEPRTDTNSSPSRASVCGIFVDFASA 476

  Fly  1107 SHPEFAAPQKIMSKSNS 1123
            ||.:.:..|.:..|..|
Human   477 SHRQKSRTQALKQKMRS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14838NP_648138.1 WD40 328..>599 CDD:225201
WD40 repeat 462..505 CDD:293791
WD40 repeat 510..547 CDD:293791
RE_R_Pab1 807..>863 CDD:286594 3/8 (38%)
DYNC2I1XP_006716104.1 WD40 630..1020 CDD:225201
WD40 repeat 648..676 CDD:293791
WD40 repeat 736..778 CDD:293791
WD40 repeat 785..814 CDD:293791
WD40 repeat 829..860 CDD:293791
WD40 <915..987 CDD:295369
WD40 repeat 916..952 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.