DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14838 and Dnai1

DIOPT Version :9

Sequence 1:NP_648138.1 Gene:CG14838 / 38851 FlyBaseID:FBgn0035799 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001019513.1 Gene:Dnai1 / 500442 RGDID:1565671 Length:705 Species:Rattus norvegicus


Alignment Length:400 Identity:78/400 - (19%)
Similarity:134/400 - (33%) Gaps:127/400 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 QSAPPKIEREQQTNPTFPSNAWSQYLYEIDDEDLELDETDVDEEEEKKKAQAKPGTYVEPEKKPP 337
            |..||     .:||.:..:|.|..|...:|    ||::.:..:|:||.|......|.....:|..
  Rat   217 QMEPP-----PRTNFSATANQWEIYDAYVD----ELEKLEKTKEKEKTKTPVAKKTEKMAMRKLT 272

  Fly   338 EMSAQ-------------IEMLLNTLEFNQI-----------DSYRDDYSLISSRQVVQYTNPYL 378
            .|.:|             :|.::|...::.:           |.|||....             |
  Rat   273 SMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYRDQEGT-------------L 324

  Fly   379 QEFLCFANISKSNKRFVAGYDWYPKLSGLIAV---SYAF----------------STPATVNEAT 424
            .....|.| .|:.:..|....|.||...|.||   ||.|                |.|..:..:.
  Rat   325 LPLWKFQN-DKAKRLAVTALCWNPKYKDLFAVGHGSYDFMKQSRGMLLLYSMKNPSFPEYMFSSE 388

  Fly   425 NRVDYVQRAVLEPNPVLLWSFSDNLN-YKLEFEAPIETTALTFCPFNGDILLGGSKNGQVV--LW 486
            :.:..:...:..|..|::..:..|:. |.|:            .|.:.......||:|:..  :|
  Rat   389 SGIMCLDMHMDHPYLVVVGYYDGNVAIYNLK------------KPHSQPCFRSTSKSGKHTDPVW 441

  Fly   487 DLQGRCEKLDEEEYLTAAQAKYRIMIGEFLNWTIDIEDNVIVPATISL------------LDCSP 539
            .::.:.:.:|......:..:.     |..::||: ::..::....|.|            |....
  Rat   442 QVKWQKDDMDHNLNFFSVSSD-----GRIVSWTL-VKSELVHIDVIKLKDEGSTTEIPEGLQLHT 500

  Fly   540 KGAITAF-------------------YWLGRSIYLSQFGKVYN------DPDIRN--HHKFFVTC 577
            .|..|||                   |...:| |.|||...|:      |..:.|  |.:.|::|
  Rat   501 VGCGTAFDFHKEIDYLFLVGTEEGKIYKCSKS-YSSQFLDTYDAHNMAVDAVLWNPYHARVFISC 564

  Fly   578 AFDGTISFWD 587
            :.|.|:..||
  Rat   565 SSDWTVKIWD 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14838NP_648138.1 WD40 328..>599 CDD:225201 62/344 (18%)
WD40 repeat 462..505 CDD:293791 6/44 (14%)
WD40 repeat 510..547 CDD:293791 10/67 (15%)
RE_R_Pab1 807..>863 CDD:286594
Dnai1NP_001019513.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..169
WD40 325..683 CDD:225201 51/269 (19%)
WD40 repeat 340..386 CDD:293791 12/45 (27%)
WD40 <358..616 CDD:295369 41/235 (17%)
WD 1 386..426 6/51 (12%)
WD40 repeat 392..433 CDD:293791 7/52 (13%)
WD 2 435..478 5/48 (10%)
WD40 repeat 440..494 CDD:293791 7/59 (12%)
WD40 repeat 505..542 CDD:293791 9/37 (24%)
WD 3 543..583 8/31 (26%)
WD40 repeat 548..587 CDD:293791 8/26 (31%)
WD 4 585..625
WD40 repeat 590..631 CDD:293791
WD 5 633..672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.