DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14838 and Sdic3

DIOPT Version :9

Sequence 1:NP_648138.1 Gene:CG14838 / 38851 FlyBaseID:FBgn0035799 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001285482.2 Gene:Sdic3 / 318231 FlyBaseID:FBgn0052823 Length:533 Species:Drosophila melanogaster


Alignment Length:669 Identity:129/669 - (19%)
Similarity:211/669 - (31%) Gaps:265/669 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 NVSVQSAPPK----IEREQQTNPTFPSNAWSQYLYEIDDEDLELDETDVDEEEEKKK------AQ 323
            ||...:.|||    ..::.||..|...|.          :.|..|....|||...:.      ::
  Fly    30 NVQATNIPPKETLVYTKQTQTTSTGGGNG----------DVLAFDAQGDDEESSLQNLGNGFTSK 84

  Fly   324 AKPG--TY-------VEPEKKPPEMSAQIEMLLNTLEFNQIDSYRDDYSLIS------------- 366
            ..||  |:       |.|...|.|:..:.|:   ..|.|::...:....::|             
  Fly    85 LPPGYLTHGLPTVKDVAPAITPLEIKKETEV---KKEVNELSEEQKQMIILSENFQRFVVRAGRV 146

  Fly   367 -----SRQVVQYTNPYL-----QEFLCFANISKSNKRF----------------VAGYDWYPKLS 405
                 |..|..||: |:     :|    ||..:|:.|.                :...||.....
  Fly   147 IERALSENVDIYTD-YIGGGDSEE----ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFP 206

  Fly   406 GLIAVSYAFSTPATVNEATNRVDYVQRAVLEPNPVLLWSFSDNLNYKLE-----FEAPIETTALT 465
            .|:..||..:     .|:.|..|.|         |::|    |..:|..     |.......:..
  Fly   207 ELVVGSYHNN-----EESPNEPDGV---------VMVW----NTKFKKSTPEDVFHCQSAVMSTC 253

  Fly   466 FCPFNGDILLGGSKNGQVVLWDLQGRCEKLD--EEEYLTAAQAKYRI----MIGEFLNWTIDIED 524
            |..||.:::|||:.:||:||||  .|.:|..  :...|:||...:.:    |:|           
  Fly   254 FAKFNPNLILGGTYSGQIVLWD--NRVQKRTPIQRTPLSAAAHTHPVYCLQMVG----------- 305

  Fly   525 NVIVPATISLLDCSPKGAITAFYWLGRSIYLSQFGKVYNDPDIRNHHKFFVTCAFDGTISFWDLD 589
                                                      .:|.|. .::.:.||.:..|.||
  Fly   306 ------------------------------------------TQNAHN-VISISSDGKLCSWSLD 327

  Fly   590 GKGGKSAKDKMRNRMLPK-----ELTQSESAFKSMVIKPTYNLYFPEPITGIIADTSCLSCLTPV 649
                          ||.:     ||.|.:|  |::.|.   ::.||                   
  Fly   328 --------------MLSQPQDTLELQQRQS--KAIAIT---SMAFP------------------- 354

  Fly   650 AKLIQANPSNYPIKTIAKDPPTMRQSMIVSTFYGHVSRIDWQGTYTEGEATEVINSSIPFAMVHD 714
                 ||..|               |:::.:..|:|......|  ......||...       |.
  Fly   355 -----ANEIN---------------SLVMGSEDGYVYSASRHG--LRSGVNEVYER-------HL 390

  Fly   715 GPVVMV-----KKNPFYPELF--ASIGRTILAIWKEDYNYSPIFWRKRACD-LTAVAWSETRPAV 771
            ||:..:     :.:|.:..||  :||..|| .:|... :..|::..:...| :..||||...||:
  Fly   391 GPITGISTHYNQLSPDFGHLFLTSSIDWTI-KLWSLK-DTKPLYSFEDNSDYVMDVAWSPVHPAL 453

  Fly   772 LYLTRIDGILEAWDILARDDDACLTEILGGGIITAITEHRPSLPHKILGIGDYNSSIRMVKLPHS 836
            .......|.|:.|: |.:|.:..:..|:..|        .|:|.             |:...|..
  Fly   454 FAAVDGSGRLDLWN-LNQDTEVPIASIVVAG--------APALN-------------RVSWTPSG 496

  Fly   837 FDVPLPNELDQLIKYVLKE 855
            ..|.:.:|..:|..|.:.|
  Fly   497 LHVCIGDEAGKLYVYDVAE 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14838NP_648138.1 WD40 328..>599 CDD:225201 59/327 (18%)
WD40 repeat 462..505 CDD:293791 16/44 (36%)
WD40 repeat 510..547 CDD:293791 2/40 (5%)
RE_R_Pab1 807..>863 CDD:286594 9/49 (18%)
Sdic3NP_001285482.2 Dynein_IC2 23..51 CDD:288403 6/20 (30%)
NtpH 108..>178 CDD:225368 14/77 (18%)
WD40 196..512 CDD:295369 92/480 (19%)
WD40 repeat 196..245 CDD:293791 14/66 (21%)
WD40 <224..523 CDD:225201 87/452 (19%)
WD40 repeat 251..289 CDD:293791 14/39 (36%)
WD40 repeat 298..337 CDD:293791 11/106 (10%)
WD40 repeat 349..435 CDD:293791 23/138 (17%)
WD40 repeat 441..479 CDD:293791 11/38 (29%)
WD40 repeat 487..513 CDD:293791 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.