DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and PELPK2

DIOPT Version :10

Sequence 1:NP_648137.3 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_196514.1 Gene:PELPK2 / 830811 AraportID:AT5G09520 Length:130 Species:Arabidopsis thaliana


Alignment Length:97 Identity:41/97 - (42%)
Similarity:49/97 - (50%) Gaps:15/97 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1008 EFPKFPVLPEIPTASSLPESPKIELKTPKYPDFTELSNEIPENPKKPAEFDYPE-PKFPSLPKWE 1071
            |.|.||.||: |....|||.||:||  ||.|:..:     ||.||.| |...|| |.||.|||..
plant    42 EIPTFPELPK-PEMPKLPEFPKLEL--PKLPEIPK-----PEMPKLP-EIQKPELPTFPELPKMP 97

  Fly  1072 GLPK--LPPLADIP---TSKAPVPLRPEVPKS 1098
            ..||  .|.|.::|   .:|.|....|:.|.|
plant    98 EFPKFDFPKLPELPKPEETKVPAFTMPKFPGS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_648137.3 FXa_inhibition 296..331 CDD:464251
cEGF 396..415 CDD:463661
FXa_inhibition 425..458 CDD:464251
FXa_inhibition 476..505 CDD:464251
EGF_CA 552..>581 CDD:214542
FXa_inhibition 596..630 CDD:464251
FXa_inhibition 636..>664 CDD:464251
EGF_CA 676..711 CDD:214542
FXa_inhibition 745..780 CDD:464251
FXa_inhibition 786..821 CDD:464251
vWFA <821..861 CDD:469594
FXa_inhibition 874..904 CDD:464251
FXa_inhibition 945..980 CDD:464251
PTZ00449 <1017..>1098 CDD:185628 34/86 (40%)
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
HYR 1468..1536 CDD:460572
PELPK2NP_196514.1 PspC_subgroup_2 <36..>127 CDD:468202 39/93 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.