DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and si:dkey-258f14.3

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:XP_021334056.1 Gene:si:dkey-258f14.3 / 571152 ZFINID:ZDB-GENE-050809-43 Length:526 Species:Danio rerio


Alignment Length:223 Identity:63/223 - (28%)
Similarity:98/223 - (43%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 CQDINECEVDGPEDLDNNAVCQQKCEN-TIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNR 473
            |..:|:|. ||.:::        .|.| |.|||.|...|         ||...|..         
Zfish    57 CDAVNDCG-DGSDEI--------SCWNCTNGSFHCVASE---------SCVSSSSV--------- 94

  Fly   474 TRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCI 538
                  |...|:      |..|.:...|..:...|..||:..:..  |:.|.|:.:......|..
Zfish    95 ------CDGRPD------CADGADEQLDTCTSFSQAQPCARSEFT--CTNGQCVPNSWRCDHSSD 145

  Fly   539 CPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGC 603
            |..|  |:...| |.:|||.:...|||||.:.|.|::|.||:|:.||::..|...:.| ::.:.|
Zfish   146 CKDG--SDEEDC-DHNECAVNNGGCSHTCIDLPFGFRCDCPKGMRLVQDTHCEVVDQC-LDADVC 206

  Fly   604 EQICLTARGG-VCACREGFRLSADGKSC 630
            :|||:.:.|. ||.|::|::|:|....|
Zfish   207 DQICVHSNGSVVCDCQDGYQLTAGTGQC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433 1/4 (25%)
FXa_inhibition 425..458 CDD:291342 8/33 (24%)
FXa_inhibition 476..505 CDD:291342 5/28 (18%)
vWFA <550..586 CDD:294047 17/35 (49%)
FXa_inhibition 596..630 CDD:291342 12/34 (35%)
FXa_inhibition 636..>664 CDD:291342
EGF_CA 676..715 CDD:284955
FXa_inhibition 745..780 CDD:291342
FXa_inhibition 786..821 CDD:291342
FXa_inhibition 827..862 CDD:291342
FXa_inhibition 874..904 CDD:291342
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
si:dkey-258f14.3XP_021334056.1 LDLa 38..72 CDD:238060 5/23 (22%)
PRKCSH-like <45..>112 CDD:193472 21/93 (23%)
LDLa 121..155 CDD:238060 8/37 (22%)
FXa_inhibition 160..193 CDD:317114 15/32 (47%)
Ldl_recept_b 367..407 CDD:278487
LY 393..433 CDD:214531
LY 434..476 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.