DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and ccbe1

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:524 Identity:121/524 - (23%)
Similarity:162/524 - (30%) Gaps:206/524 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 EDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCEN 695
            ||||         ::||     |...|....|..:|..|      ::..|.::.  |     ||.
Zfish    32 EDVD---------REVC-----SESKIATTKYPCVKSTG------EVTTCYRKK--C-----CEG 69

  Fly   696 LNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCL--DIDECSLANGNCSHFCQN 758
            ..          :.||                          .|:  |.|.|  |...|...|.:
Zfish    70 FK----------FVLG--------------------------QCIPEDYDVC--AGAPCEQQCTD 96

  Fly   759 EPGGFQCACPLGYALSEDMRT------CQDIDECLDSNGQ-CSQLCLNQPGGFACACETGFELTP 816
            ..|...|.|..||....:...      |.|||||.::|.. |||:|:|.||.:.|.|.:||.|..
Zfish    97 HFGRVVCTCYDGYRYDRERHRNREKPYCLDIDECANNNETVCSQMCVNTPGSYRCDCHSGFYLED 161

  Fly   817 DGFGC-----ADIDECSQDYGNCSDICINLL--GTHACACERGYELAKDKLSCLDVDECAGLLSG 874
            ||..|     |.:.|.|.          |::  ||.:..||..:::   |::.|.:.:...||| 
Zfish   162 DGKTCTKGERAPLFEKSD----------NVMKEGTCSATCEDFHQM---KMTVLQLKQKMSLLS- 212

  Fly   875 GCSHECINKAGTFE-------------------CGCPLGYILNDDGRSCSPALVGCPPGTQRSAD 920
              |:..|||..|.|                   .|.|     ...|.|.||..:| |||......
Zfish   213 --SNTEINKQMTNEKMMMTTNSFLPGPPGPPGPAGTP-----GAKGSSGSPGQMG-PPGLPGPRG 269

  Fly   921 GCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDE 985
            ...||..:|           |:          ||......|...   |||.......|       
Zfish   270 DMGPIGPSP-----------DL----------SHIKQGRRGPVG---PPGAPGRDGMK------- 303

  Fly   986 CDQDKTSCITGTCINEIGGFRCEFPKFPVLPEIPTASSLPESPKIELKTPKYPDF-----TELSN 1045
                          .|.|        ||       ..|.|..|      |...||     .::.|
Zfish   304 --------------GERG--------FP-------GPSGPPGP------PGSFDFLLLMMADIRN 333

  Fly  1046 EIPENPKK----PAEFDYPEPKFPSLP-KWEGLPKLPPLADIPTSKAPVPLRPEVPKSLWVNQLQ 1105
            :|.|...|    |....:.:  |||.| .|...|:..........|:..|     |||....:| 
Zfish   334 DIAELQSKVFSRPLHSSFED--FPSAPDSWRDTPENLDFGSGEDYKSQSP-----PKSSRKRKL- 390

  Fly  1106 PRDL 1109
            ||:|
Zfish   391 PRNL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342
FXa_inhibition 476..505 CDD:291342
vWFA <550..586 CDD:294047
FXa_inhibition 596..630 CDD:291342
FXa_inhibition 636..>664 CDD:291342 5/27 (19%)
EGF_CA 676..715 CDD:284955 6/38 (16%)
FXa_inhibition 745..780 CDD:291342 9/40 (23%)
FXa_inhibition 786..821 CDD:291342 16/35 (46%)
FXa_inhibition 827..862 CDD:291342 7/36 (19%)
FXa_inhibition 874..904 CDD:291342 9/48 (19%)
FXa_inhibition 945..980 CDD:291342 7/34 (21%)
CCP 1110..1170 CDD:153056 121/524 (23%)
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:291342 16/35 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321 29/163 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.