DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and matn1

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_001093210.1 Gene:matn1 / 403023 ZFINID:ZDB-GENE-050307-3 Length:489 Species:Danio rerio


Alignment Length:177 Identity:45/177 - (25%)
Similarity:67/177 - (37%) Gaps:70/177 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 EPLEENPEITE---VVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPE 422
            ||||::.:..|   ::|...:|..|                         ..|..:::....|..
Zfish   190 EPLEDHVDYVESYSLIEKLTKKFQE-------------------------AFCAVVSDLCATGDH 229

  Fly   423 DLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQD---LP 484
            |      |:..|.:|.|||:|.|.||:.|:.|.|||               :.|::...|   |.
Zfish   230 D------CEHICISTPGSFKCACREGFTLMNDSRSC---------------SACSNAATDVVFLI 273

  Fly   485 EGSYRCVCPKGYEL--------------SE-DQHSCLVQESPCSTEK 516
            :|| :.|.|:.:||              || :.|..|||.|  ||.|
Zfish   274 DGS-KSVRPENFELVKKWINLIIDKLDVSETNTHVGLVQYS--STVK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433 1/18 (6%)
FXa_inhibition 425..458 CDD:291342 13/32 (41%)
FXa_inhibition 476..505 CDD:291342 12/46 (26%)
vWFA <550..586 CDD:294047
FXa_inhibition 596..630 CDD:291342
FXa_inhibition 636..>664 CDD:291342
EGF_CA 676..715 CDD:284955
FXa_inhibition 745..780 CDD:291342
FXa_inhibition 786..821 CDD:291342
FXa_inhibition 827..862 CDD:291342
FXa_inhibition 874..904 CDD:291342
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
matn1NP_001093210.1 vWA_Matrilin 35..258 CDD:238752 23/98 (23%)
vWA_Matrilin 265..489 CDD:238752 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.