DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and Egfl6

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:XP_008771393.1 Gene:Egfl6 / 317470 RGDID:1563321 Length:551 Species:Rattus norvegicus


Alignment Length:225 Identity:79/225 - (35%)
Similarity:104/225 - (46%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 RCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDI 553
            :..|..|::    ::|..|.|:.|.     .:|..|.|:...     .|.|..||..:..| ||:
  Rat    44 KTACCYGWK----RNSKGVCEAVCE-----PRCKFGECVGPN-----KCRCFPGYTGKTCS-QDV 93

  Fly   554 DECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICL-TARGGVCAC 617
            :|||.....|.|.|.||.|.|:|.|..|..|:.:.||.....|...|  |:..|. ||.|..|.|
  Rat    94 NECAFKPRPCQHRCVNTHGSYKCFCLSGHMLLPDATCSNSRTCARIN--CQYSCEDTAEGPRCVC 156

  Fly   618 -REGFRLSADGKSCEDVDECLVNNGGC--QQVCRNLPGSYGCICAAGYELLKLDGIRGY-CFDID 678
             ..|.||..:|:.|.|:|||..:...|  .:.|.|..|||.|.|..|:||..:.  |.| |.||:
  Rat   157 PSSGLRLGPNGRVCLDIDECASSKAVCPSNRRCVNTFGSYYCKCHIGFELKYIS--RRYDCVDIN 219

  Fly   679 ECSQRTHGCSDQMLCENLNGSYTCLCPPGY 708
            ||:..|..||....|.|..||:.|.|..||
  Rat   220 ECTLNTRTCSPHANCLNTQGSFKCKCKQGY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342
FXa_inhibition 476..505 CDD:291342 2/15 (13%)
vWFA <550..586 CDD:294047 16/35 (46%)
FXa_inhibition 596..630 CDD:291342 13/35 (37%)
FXa_inhibition 636..>664 CDD:291342 10/29 (34%)
EGF_CA 676..715 CDD:284955 15/33 (45%)
FXa_inhibition 745..780 CDD:291342
FXa_inhibition 786..821 CDD:291342
FXa_inhibition 827..862 CDD:291342
FXa_inhibition 874..904 CDD:291342
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Egfl6XP_008771393.1 EGF_CA 92..123 CDD:214542 14/30 (47%)
EGF_CA 172..205 CDD:214542 13/32 (41%)
EGF_3 221..256 CDD:289699 12/29 (41%)
MAM 400..543 CDD:279023
MAM 400..542 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.