DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and Vwa2

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:XP_003749194.3 Gene:Vwa2 / 307988 RGDID:1562000 Length:792 Species:Rattus norvegicus


Alignment Length:224 Identity:47/224 - (20%)
Similarity:79/224 - (35%) Gaps:71/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 EPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQ-DINECE---VDGP 421
            ||.|::..:.|.||   :.||.:...:|.|    ..|.     :|| .||: :...||   ::..
  Rat   207 EPKEQHVLLAEQVE---DATNGLLSTLSSS----LLCT-----TAD-PDCRVEAYPCERRTLETM 258

  Fly   422 EDLDNNAVCQQ--KCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLP 484
            .:|.:||:|.:  :..:|:.:..|.......:.                            |..|
  Rat   259 RELASNALCWRGSRQADTVLAVPCPFYSWKRVF----------------------------QTHP 295

  Fly   485 EGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKC-SPGTCLASEDNTSFSCICPTGYRSEAF 548
            ...||.:||                .||.:    :.| :.|||: .|....:.|:||..:..|..
  Rat   296 ANCYRTICP----------------GPCDS----QPCQNGGTCI-PEGVDRYHCLCPLAFGGEVN 339

  Fly   549 SCQDID-ECAEDT-HLCSHTCQNTPGGYQ 575
            ....:. ||..|. .|...:...||.|::
  Rat   340 CAPKLSLECRIDVLFLLDSSAGTTPEGFR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433 5/19 (26%)
FXa_inhibition 425..458 CDD:291342 5/34 (15%)
FXa_inhibition 476..505 CDD:291342 6/28 (21%)
vWFA <550..586 CDD:294047 7/28 (25%)
FXa_inhibition 596..630 CDD:291342
FXa_inhibition 636..>664 CDD:291342
EGF_CA 676..715 CDD:284955
FXa_inhibition 745..780 CDD:291342
FXa_inhibition 786..821 CDD:291342
FXa_inhibition 827..862 CDD:291342
FXa_inhibition 874..904 CDD:291342
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Vwa2XP_003749194.3 vWA_collagen 59..213 CDD:238749 3/5 (60%)
EGF 307..337 CDD:278437 9/34 (26%)
vWFA 350..510 CDD:294047 5/19 (26%)
vWFA 539..689 CDD:294047
EGF_CA 726..756 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.