DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and Matn4

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_001100009.1 Gene:Matn4 / 296358 RGDID:1309732 Length:624 Species:Rattus norvegicus


Alignment Length:224 Identity:72/224 - (32%)
Similarity:95/224 - (42%) Gaps:42/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   698 GSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDI---------------DECSL 747
            ||...:..|    .||.|:       |:.:|           .|:               |.|:.
  Rat   181 GSLRAMASP----PLDQHV-------FLVES-----------FDLIQEFGLQFQGRLCGKDLCAE 223

  Fly   748 ANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGF 812
            ....|.|.|.|.||.|.|||..||.|:.|.|.|..||.|.:....|..||::....:.|.|..||
  Rat   224 LEHGCQHLCVNAPGTFYCACNSGYKLAPDNRN
CLAIDLCAEGTHGCEHLCVSSVDSYFCRCRAGF 288

  Fly   813 ELTPDGFGCADIDECSQDYGN--CSDICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGG 875
            .|..|...|..||.||  :||  |...|::.|....|.|..|::|..|..||...|.|.| :..|
  Rat   289 ALQQDQRSC
RAIDYCS--FGNHSCQHECVSTLVGPQCRCREGHDLLPDGRSCQVRDFCNG-VDHG 350

  Fly   876 CSHECINKAGTFECGCPLGYILNDDGRSC 904
            |..:|:::..:|.|.||.|..|..||:||
  Rat   351 CEFQCVSEGLSFHCLCPEGRRLQADGKSC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342
FXa_inhibition 476..505 CDD:291342
vWFA <550..586 CDD:294047
FXa_inhibition 596..630 CDD:291342
FXa_inhibition 636..>664 CDD:291342
EGF_CA 676..715 CDD:284955 5/16 (31%)
FXa_inhibition 745..780 CDD:291342 16/34 (47%)
FXa_inhibition 786..821 CDD:291342 10/34 (29%)
FXa_inhibition 827..862 CDD:291342 12/36 (33%)
FXa_inhibition 874..904 CDD:291342 11/29 (38%)
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Matn4NP_001100009.1 vWA_Matrilin 33..255 CDD:238752 25/95 (26%)
FXa_inhibition 262..297 CDD:291342 10/34 (29%)
FXa_inhibition 303..338 CDD:291342 12/36 (33%)
FXa_inhibition 344..379 CDD:291342 13/35 (37%)
vWFA 385..621 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.