DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and CD93

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_036204.2 Gene:CD93 / 22918 HGNCID:15855 Length:652 Species:Homo sapiens


Alignment Length:637 Identity:152/637 - (23%)
Similarity:201/637 - (31%) Gaps:227/637 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 YLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNV 387
            |...|||..           ::..|..|....|:...|:..||...:..|:...:.:...:...:
Human    37 YTAHSGKLS-----------AAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARM 90

  Fly   388 SE-----SQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVE 447
            |:     .:..||..:....|.....         |.|.||                    |...
Human    91 SKFWIGLQREKGKCLDPSLPLKGFSW---------VGGGED--------------------TPYS 126

  Fly   448 GYHLLEDQRSCALDSCT----DLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQ 508
            .:| .|.:.||....|.    ||..|.|.        ..||:.|                     
Human   127 NWH-KELRNSCISKRCVSLLLDLSQPLLP--------SRLPKWS--------------------- 161

  Fly   509 ESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGG 573
            |.||.        |||:               .|...|.|.|:     .....:|.......||.
Human   162 EGPCG--------SPGS---------------PGSNIEGFVCK-----FSFKGMCRPLALGGPGQ 198

  Fly   574 YQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREG------------------ 620
            .....|                .:..::..|.:...:...| ||.||                  
Human   199 VTYTTP----------------FQTTSSSLEAVPFASAANV-ACGEGDKDETQSHYFLCKEKAPD 246

  Fly   621 -FRLSADGKSCEDVD-ECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQR 683
             |...:.|..|.... .|..|||||.|.|                                    
Human   247 VFDWGSSGPLCVSPKYGCNFNNGGCHQDC------------------------------------ 275

  Fly   684 THGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLA 748
                     .|..:||:.|.|.||:.| ||:.:                     ||...:.||.:
Human   276 ---------FEGGDGSFLCGCRPGFRL-LDDLV---------------------TCASRNPCSSS 309

  Fly   749 NGNCSHFCQNEPGG--FQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETG 811
            .......|...|.|  :.|.||.||.|......|.|:|||.||  .|:|.|:|.||||.|.|..|
Human   310 PCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDS--PCAQECVNTPGGFRCECWVG 372

  Fly   812 FELTPDGFG---CADIDECSQDYGNCSDICINLLGTHACACERGYELA-KDKLSCLDVDECAGLL 872
            :|  |.|.|   |.|:|||:.....|:..|.|..|:..|:||.||.|| :|...|.|||||.|  
Human   373 YE--PGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVG-- 433

  Fly   873 SGG--CSHECINKAGTFECGCPLGYILNDDGRSCS--PALVGCPPGTQRSAD 920
            .||  |...|.|..|:|.|||..|::|..:|.||:  |..:|.|.|.....|
Human   434 PGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEED 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342 4/7 (57%)
cEGF 396..415 CDD:289433 1/18 (6%)
FXa_inhibition 425..458 CDD:291342 3/32 (9%)
FXa_inhibition 476..505 CDD:291342 3/28 (11%)
vWFA <550..586 CDD:294047 5/35 (14%)
FXa_inhibition 596..630 CDD:291342 8/52 (15%)
FXa_inhibition 636..>664 CDD:291342 8/27 (30%)
EGF_CA 676..715 CDD:284955 10/38 (26%)
FXa_inhibition 745..780 CDD:291342 11/36 (31%)
FXa_inhibition 786..821 CDD:291342 18/37 (49%)
FXa_inhibition 827..862 CDD:291342 13/35 (37%)
FXa_inhibition 874..904 CDD:291342 13/31 (42%)
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
CD93NP_036204.2 CLECT_thrombomodulin_like 31..184 CDD:153070 42/244 (17%)
FXa_inhibition 264..300 CDD:317114 18/102 (18%)
cEGF 326..348 CDD:315355 8/21 (38%)
EGF_CA 345..>369 CDD:214542 15/25 (60%)
EGF_CA 385..425 CDD:311536 16/39 (41%)
EGF_CA 427..468 CDD:214542 20/42 (48%)
WTX <464..>549 CDD:312801 8/22 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..546 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..572
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.