DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and Efemp1

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_666127.2 Gene:Efemp1 / 216616 MGIID:1339998 Length:493 Species:Mus musculus


Alignment Length:403 Identity:127/403 - (31%)
Similarity:164/403 - (40%) Gaps:86/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 CPTGYRSEAF--SCQDIDECAEDTHLC--SHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVN 599
            |..||..:..  .|:|||||......|  ...|.|..|||.| .|:...::            ||
Mouse    29 CTDGYEWDPIRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC-LPKTAQII------------VN 80

  Fly   600 NNGCEQICLTARG------GVCACRE----------GFRLSADGKSCEDVDECLVNNGGCQQVCR 648
            |...:|....|..      |..|.|.          ||..||...:..:     |..|....|.|
Mouse    81 NEHPQQETPAAEASSGATTGTVAARSMATSGVVPGGGFMASATAVAGPE-----VQTGRNNFVIR 140

  Fly   649 NLPG---------SYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLC 704
            ..|.         |:...||||||    ......|.|||||:..||.|....:|.||.||:||.|
Mouse   141 RNPADPQRIPSNPSHRIQCAAGYE----QSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQC 201

  Fly   705 PPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPL 769
            .|||                        ......|:|||||::. ..|...|.|.||.|.|.|..
Mouse   202 LPGY------------------------QKRGEQCVDIDECTVP-PYCHQRCVNTPGSFYCQCSP 241

  Fly   770 GYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNC 834
            |:.|:.:..||.||:|| |::.||:|.|.|..|.|.|.|..|:||:.|...|.|||||......|
Mouse   242 GFQLAANNYTCVDINEC-DASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLC 305

  Fly   835 SDICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHE--CINKAGTFEC----GCPL 893
            ...|:|..|..:|.|.:|||:.:.: :|.|::||.  .:..|..:  |.|..|.|.|    .|..
Mouse   306 QYQCVNEPGKFSCMCPQGYEVVRSR-TCQDINECE--TTNECREDEMCWNYHGGFRCYPRNPCQD 367

  Fly   894 GYILNDDGRSCSP 906
            .|:|..:.|...|
Mouse   368 HYVLTSENRCVCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342
FXa_inhibition 476..505 CDD:291342
vWFA <550..586 CDD:294047 14/37 (38%)
FXa_inhibition 596..630 CDD:291342 12/49 (24%)
FXa_inhibition 636..>664 CDD:291342 11/36 (31%)
EGF_CA 676..715 CDD:284955 19/38 (50%)
FXa_inhibition 745..780 CDD:291342 11/34 (32%)
FXa_inhibition 786..821 CDD:291342 15/34 (44%)
FXa_inhibition 827..862 CDD:291342 10/34 (29%)
FXa_inhibition 874..904 CDD:291342 10/35 (29%)
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Efemp1NP_666127.2 EGF_CA 173..>206 CDD:311536 19/56 (34%)
EGF_CA 214..244 CDD:214542 14/30 (47%)
cEGF 234..257 CDD:372248 9/22 (41%)
Mediates interaction with TIMP3. /evidence=ECO:0000250 259..493 44/125 (35%)
cEGF 274..297 CDD:372248 10/22 (45%)
EGF_CA 294..333 CDD:214542 14/39 (36%)
EGF_CA 334..>359 CDD:214542 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11624
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.