| Sequence 1: | NP_001137905.1 | Gene: | frac / 38850 | FlyBaseID: | FBgn0035798 | Length: | 1618 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_034900.4 | Gene: | Matn3 / 17182 | MGIID: | 1328350 | Length: | 481 | Species: | Mus musculus |
| Alignment Length: | 250 | Identity: | 83/250 - (33%) |
|---|---|---|---|
| Similarity: | 115/250 - (46%) | Gaps: | 29/250 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 708 YALGLDNHIVTSLNSS----------FITDSTSSETPSA---HTCLDIDECSLANGNCSHFCQNE 759
Fly 760 -PGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLN-QPGGFACACETGFELTPDGFGCA 822
Fly 823 DIDECSQDYGNCSDICIN-LLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINK-AG 885
Fly 886 TFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIE--CNPGYTLGSDDK 938 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| frac | NP_001137905.1 | FXa_inhibition | 296..331 | CDD:291342 | |
| cEGF | 396..415 | CDD:289433 | |||
| FXa_inhibition | 425..458 | CDD:291342 | |||
| FXa_inhibition | 476..505 | CDD:291342 | |||
| vWFA | <550..586 | CDD:294047 | |||
| FXa_inhibition | 596..630 | CDD:291342 | |||
| FXa_inhibition | 636..>664 | CDD:291342 | |||
| EGF_CA | 676..715 | CDD:284955 | 4/6 (67%) | ||
| FXa_inhibition | 745..780 | CDD:291342 | 12/35 (34%) | ||
| FXa_inhibition | 786..821 | CDD:291342 | 12/35 (34%) | ||
| FXa_inhibition | 827..862 | CDD:291342 | 14/35 (40%) | ||
| FXa_inhibition | 874..904 | CDD:291342 | 13/30 (43%) | ||
| FXa_inhibition | 945..980 | CDD:291342 | |||
| CCP | 1110..1170 | CDD:153056 | |||
| CCP | 1183..1235 | CDD:153056 | |||
| DUF5011 | 1468..1536 | CDD:295940 | |||
| Matn3 | NP_034900.4 | vWFA | 75..298 | CDD:294047 | 23/84 (27%) |
| FXa_inhibition | 305..341 | CDD:291342 | 12/35 (34%) | ||
| FXa_inhibition | 347..383 | CDD:291342 | 14/35 (40%) | ||
| FXa_inhibition | 389..425 | CDD:291342 | 16/36 (44%) | ||
| Matrilin_ccoil | 438..478 | CDD:287378 | 5/14 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||