DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and Gas6

DIOPT Version :10

Sequence 1:NP_648137.3 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_062394.2 Gene:Gas6 / 14456 MGIID:95660 Length:674 Species:Mus musculus


Alignment Length:300 Identity:84/300 - (28%)
Similarity:123/300 - (41%) Gaps:78/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 GGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDEC 636
            |..:.:|      ||| .|..|...||..|..|......|...|..:.|   ..:.|: .|..:|
Mouse    56 GHLEREC------VEE-VCSKEEAREVFENDPETEYFYPRYQECMRKYG---RPEEKN-PDFAKC 109

  Fly   637 LVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYT 701
            :          :|||                          |:|:..........:|::|.|::.
Mouse   110 V----------QNLP--------------------------DQCTPNPCDKKGTHICQDLMGNFF 138

  Fly   702 CLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTC-LDIDECSLANGNCSHFCQNEPGGFQC 765
            |:|..|:                          ....| .|::||...||.||..|.|:||.|||
Mouse   139 CVCTDGW--------------------------GGRLCDKDVNECVQKNGGCSQVCHNKPGSFQC 177

  Fly   766 ACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQD 830
            ||..|::|:.|.:||||||||.||:......|.|.||.::|.|:.|:..:.....|.|:|||.||
Mouse   178 ACHSGFSLASDGQTCQDIDECTDSDTCGDARCKNLPGSYSCLCDEGYTYSSKEKTCQDVDECQQD 242

  Fly   831 YGNCSDICINLLGTHACACE--RGYELAKDKLSCLDVDEC 868
              .|...|:|..|::.|.|:  .|.:|:.|..:|.|:..|
Mouse   243 --RCEQTCVNSPGSYTCHCDGRGGLKLSPDMDTCEDILPC 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_648137.3 FXa_inhibition 296..331 CDD:464251
cEGF 396..415 CDD:463661
FXa_inhibition 425..458 CDD:464251
FXa_inhibition 476..505 CDD:464251
EGF_CA 552..>581 CDD:214542 2/8 (25%)
FXa_inhibition 596..630 CDD:464251 8/33 (24%)
FXa_inhibition 636..>664 CDD:464251 4/27 (15%)
EGF_CA 676..711 CDD:214542 8/34 (24%)
FXa_inhibition 745..780 CDD:464251 17/34 (50%)
FXa_inhibition 786..821 CDD:464251 10/34 (29%)
vWFA <821..861 CDD:469594 16/41 (39%)
FXa_inhibition 874..904 CDD:464251
FXa_inhibition 945..980 CDD:464251
PTZ00449 <1017..>1098 CDD:185628
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
HYR 1468..1536 CDD:460572
Gas6NP_062394.2 GLA 26..90 CDD:214503 12/40 (30%)
FXa_inhibition 157..192 CDD:464251 17/34 (50%)
EGF_CA 194..225 CDD:214542 14/30 (47%)
FXa_inhibition 244..274 CDD:464251 9/29 (31%)
LamG 295..447 CDD:238058
LamG 509..647 CDD:214598
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.