DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and FBLN5

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:NP_001371087.1 Gene:FBLN5 / 10516 HGNCID:3602 Length:489 Species:Homo sapiens


Alignment Length:504 Identity:146/504 - (28%)
Similarity:199/504 - (39%) Gaps:135/504 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCE 631
            |..:||..|.||..|.:|..:             :|             .|.:|..||:....| 
Human    16 CLPSPGNAQAQCTNGFDLDRQ-------------SG-------------QCLDGVSLSSPRLEC- 53

  Fly   632 DVDECLVNNGGCQQVCR-NLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCEN 695
                    ||.....|. .||||.....:|.    ::.||.    |||||......|...|:|.|
Human    54 --------NGAISAHCNLCLPGSSDSSASAS----QVAGIT----DIDECRTIPEACRGDMMCVN 102

  Fly   696 LNGSYTCL--CPPGYALGLDNHIVTSLNSSFITDSTSSETPS------------------AHTCL 740
            .||.|.|:  ..|.|.....|...|..:..:...:.....|:                  ::.|:
Human   103 QNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCV 167

  Fly   741 DIDECSLANGNC--SHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGG 803
            |:|||:..:..|  :..|.|..||:.|:|..||.|.|..  |.|||||  ..|.|.|||.|.||.
Human   168 DVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQ--CLDIDEC--RYGYCQQLCANVPGS 228

  Fly   804 FACACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDVDEC 868
            ::|.|..||.|..||..|.|::||:.: ..|...|:|..|:..|.|:.||||.:|.:.|.|:|||
Human   229 YSCTCNPGFTLNEDGRSCQDVNECATE-NPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDEC 292

  Fly   869 AGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTL 933
            : .....|.|||:|:.||:.|.||.||||.||.|||.                            
Human   293 S-FSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQ---------------------------- 328

  Fly   934 GSDDKCVDIDECQKQNGGCS--HRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTS 992
                   ||:||:.:|..|:  ..|.|.:|.|||    .|...|...||.:              
Human   329 -------DINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNR-------------- 372

  Fly   993 CITGTCINEIGGFRCEFPKFPVL---PEIPTASSLPESPKIELKTPKYP 1038
            |:   |..|..|  |....|.:|   .::.:..|:|........|.:||
Human   373 CM---CPAENPG--CRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342
FXa_inhibition 476..505 CDD:291342
vWFA <550..586 CDD:294047 8/18 (44%)
FXa_inhibition 596..630 CDD:291342 5/33 (15%)
FXa_inhibition 636..>664 CDD:291342 8/28 (29%)
EGF_CA 676..715 CDD:284955 15/40 (38%)
FXa_inhibition 745..780 CDD:291342 12/36 (33%)
FXa_inhibition 786..821 CDD:291342 16/34 (47%)
FXa_inhibition 827..862 CDD:291342 12/34 (35%)
FXa_inhibition 874..904 CDD:291342 17/29 (59%)
FXa_inhibition 945..980 CDD:291342 13/40 (33%)
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
FBLN5NP_001371087.1 EGF_CA 168..>201 CDD:311536 12/32 (38%)
vWFA <202..245 CDD:412136 23/46 (50%)
cEGF 228..251 CDD:403760 9/22 (41%)
EGF_CA 248..286 CDD:214542 14/38 (37%)
FXa_inhibition 299..327 CDD:405372 17/27 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.