DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frac and thbd

DIOPT Version :9

Sequence 1:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster
Sequence 2:XP_012818722.2 Gene:thbd / 100485229 XenbaseID:XB-GENE-967380 Length:541 Species:Xenopus tropicalis


Alignment Length:523 Identity:140/523 - (26%)
Similarity:200/523 - (38%) Gaps:132/523 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 LASEDNTSFSCI---CPTG-YRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPE-GLNLVE 586
            ||.::.|:|:||   |..| :.|:.:      :.||.                 ||.| |.||:.
 Frog    22 LADQNLTNFTCIGQSCYLGVWNSKRY------KKAER-----------------QCTELGGNLMA 63

  Fly   587 EYTCLAENLCEV-----------------NNNGCEQICLTARGGVCACREGFRLSADGKSCEDVD 634
            ..:.:...:.|:                 ....|..|.|..||......|.....::.||.|   
 Frog    64 VRSSVEAEVIEMLMGKLGDKVASVWIGLELRGQCTDISLPLRGFQWVTGESNTNYSNWKSNE--- 125

  Fly   635 ECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGS 699
                      :.|.||       |...::.|.        ::...|..:|.|    .|||.   .
 Frog   126 ----------RKCGNL-------CVVVHKDLS--------WEEAVCDSKTDG----YLCEI---P 158

  Fly   700 YTCLCPPGY-ALGLDNHIVTSLNS-----SFITDSTSSETPSAHTCLDIDE-------------- 744
            |:..|.|.| ..|||....|.|..     :|:...|.:..||||..|..::              
 Frog   159 YSASCQPIYFPQGLDVTYETPLGMAGPGITFLPPGTKAVIPSAHLSLVCEDQGDGEMKWTSEDYG 223

  Fly   745 ---CSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFAC 806
               |.:.||.||..|..:..|.:|.|.....||:|.|:|..:...|.        |:.......|
 Frog   224 AWNCMIENGGCSFICNGDTEGSRCECGPNTNLSDDGRSCMPLPSSLQ--------CIPDQSTGTC 280

  Fly   807 ACETGFELTPDGFGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLDVDECAGL 871
            .|..||.|..||..|.|||:||.....|..:|.|..|:..|.|..|:.:. |.| |.|::|| .:
 Frog   281 VCAEGFALAEDGMTCQDIDDCSLIPDLCDQVCTNTDGSFMCTCLPGFVMV-DGL-CEDINEC-DI 342

  Fly   872 LSGGCSHECINKAGTFECGCPLGYILNDDGRS-----CSPALVGCPP-GTQRSADGCAPIECNPG 930
            .:..|.::|.|..|.|.|.|..|||:::...|     |:...  ||. ......|.|   .|..|
 Frog   343 PTTICEYDCENFPGGFSCVCGEGYIIDEKNPSRCKQFCNTTT--CPAFCNDNFVDQC---NCPDG 402

  Fly   931 YTLGSDDK----CVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKT 991
            |.|.:|::    |.|||||  :||.|...|.|..||:.|.||.|:.|:.| .:|...:...:|.|
 Frog   403 YVLDTDEELKFVCRDIDEC--ENGFCKDLCHNLPGSYACYCPEGFILEKD-NSCTPAEGSGEDLT 464

  Fly   992 SCI 994
            :.|
 Frog   465 TSI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433
FXa_inhibition 425..458 CDD:291342
FXa_inhibition 476..505 CDD:291342
vWFA <550..586 CDD:294047 8/36 (22%)
FXa_inhibition 596..630 CDD:291342 8/50 (16%)
FXa_inhibition 636..>664 CDD:291342 4/27 (15%)
EGF_CA 676..715 CDD:284955 13/39 (33%)
FXa_inhibition 745..780 CDD:291342 13/34 (38%)
FXa_inhibition 786..821 CDD:291342 9/34 (26%)
FXa_inhibition 827..862 CDD:291342 11/34 (32%)
FXa_inhibition 874..904 CDD:291342 11/34 (32%)
FXa_inhibition 945..980 CDD:291342 14/34 (41%)
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
thbdXP_012818722.2 CLECT 32..156 CDD:413318 32/178 (18%)
FXa_inhibition 227..262 CDD:405372 13/34 (38%)
cEGF 279..299 CDD:403760 9/19 (47%)
EGF_CA 297..>327 CDD:214542 11/29 (38%)
EGF_CA 336..>366 CDD:419698 10/30 (33%)
vWFA <414..451 CDD:412136 19/39 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.