DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Prss55

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:239 Identity:68/239 - (28%)
Similarity:111/239 - (46%) Gaps:18/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIG---NPGRYTVRAGSTQQR 133
            :||:.|::.:....|:|.::..:::..||..||:..||||..||...   :|....||.|:....
Mouse    59 SRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLT 123

  Fly   134 RGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPS-TRTKRFPKCYLASGWG 197
            .......|...:.|..:....|.||:.::.|..||........:.||. .....:.:|::| |||
Mouse   124 TSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPICLPLWPAPPSWHECWVA-GWG 187

  Fly   198 LT-SANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNR--DTCSGDSGGPLV- 258
            :| |.:.:::...|..|.:..:...:|.|.:.    .:...|:||...|.  |.|.|||||||| 
Mouse   188 VTNSTDKESMSTDLMKVPMRIIEWEECLQMFP----SLTTNMLCASYGNESYDACQGDSGGPLVC 248

  Fly   259 -----HNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAK 297
                 ......||.|:|..|....:||:|..:.:||.||:|:|:
Mouse   249 TTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 64/231 (28%)
Tryp_SPc 74..295 CDD:238113 65/233 (28%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.