DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG17234

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:255 Identity:76/255 - (29%)
Similarity:113/255 - (44%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LEAQDYLPT--------RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNP 120
            |.|.|:|..        ||:.|:.|...:.|:|.:|.|....:||..|.:...|:||.||.....
  Fly     9 LLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEE 73

  Fly   121 GR------YTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL 179
            |.      |.|||||......|.|..|...:.|..|:.....||:.:::|.|||.....||.:  
  Fly    74 GNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI-- 136

  Fly   180 PSTRTKRFPKCY-LASGWGLT-----SAN-----AQNVQRYLRGVIVCKVSRAKCQQDYRGTGIK 233
            |..:|..:|:.. |.||||::     |.|     .|.:..:::.:..|::               
  Fly   137 PLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL--------------- 186

  Fly   234 IYKQMICAKRKNRDTCSGDSGGPLVHNGVLYGITSFG-IGCASAKYPGVYVNVLQYTRWI 292
            ....::||....|..|.||||||||.|..|.|:.|:| .||.|:.:   :|:|..:..||
  Fly   187 FDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 70/236 (30%)
Tryp_SPc 74..295 CDD:238113 71/237 (30%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/236 (30%)
Tryp_SPc 27..243 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.