DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG34458

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:236 Identity:73/236 - (30%)
Similarity:118/236 - (50%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIG-NPGRYTVRAGSTQQRRG 135
            :||:.|:.....:.|:|.:|..|....||..:::...|:||.||.:| |||:.....|:.....|
  Fly    30 SRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAG 94

  Fly   136 -GQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLA------ 193
             ||..::.:.:.||.|:..:...|:.::||.:|:.:|..||.::|..:.:.     |.|      
  Fly    95 NGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSN-----YAADTMAMI 154

  Fly   194 SGWGLTSANAQNVQRYLRGVIVCKVSRAKC-QQDYRGTGIKIYKQMICAKRKNR--DTCSGDSGG 255
            ||:|..:.|.|...| |:...|...||..| .|:..|    :..:|:||...:.  .:|.|||||
  Fly   155 SGFGAINQNLQLPNR-LKFAQVQLWSRDYCNSQNIPG----LTDRMVCAGHPSGQVSSCQGDSGG 214

  Fly   256 PLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVA 296
            ||..:|.|:|:.|:|.||.:...|.:|..|.....|||:.|
  Fly   215 PLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 69/229 (30%)
Tryp_SPc 74..295 CDD:238113 71/231 (31%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 69/229 (30%)
Tryp_SPc 32..254 CDD:238113 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.