DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and PRSS3

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:267 Identity:85/267 - (31%)
Similarity:126/267 - (47%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NPAINAL----------EAQDYLPTR----------------IVNGKKIKCSRAPYQCALHYNNY 96
            ||..|.|          ...||||.|                ||.|...:.:..|||.:|:..::
Human    68 NPVFNWLIWKILERERHRGSDYLPIRNQNELGVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSH 132

  Fly    97 FICGCVILNRRWILTAQHCKIGNPGRYTVRAG--STQQRRGG-QLRHVQKTVCHPNYSEYTMKND 158
            | ||..:::.:|:::|.||   ...|..||.|  :.:...|. |..:..|.:.||.|:..|:.||
Human   133 F-CGGSLISEQWVVSAAHC---YKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDND 193

  Fly   159 LCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKC 223
            :.::||.:|..:...|..:.||:|......:| |.||||.|.:...:....|:.:....:::|:|
Human   194 IMLIKLSSPAVINARVSTISLPTTPPAAGTEC-LISGWGNTLSFGADYPDELKCLDAPVLTQAEC 257

  Fly   224 QQDYRGTGIKIYKQMICA--KRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVL 286
            :..|.|   ||...|.|.  ....:|:|..|||||:|.||.|.|:.|:|.|||....||||..|.
Human   258 KASYPG---KITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVY 319

  Fly   287 QYTRWIK 293
            .|..|||
Human   320 NYVDWIK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 74/239 (31%)
Tryp_SPc 74..295 CDD:238113 76/225 (34%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 73/223 (33%)
Tryp_SPc 110..328 CDD:238113 76/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.