DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and PRSS1

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:304 Identity:95/304 - (31%)
Similarity:141/304 - (46%) Gaps:45/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSGIVVIAN----LWILVVGGQSKNWSGYYVDNGTHYLLYEGPRIKPQTFLPGNISTNPAI---- 61
            |.|:|.:.:    |||||          .|.|..:            .|....:.:.||.:    
Human   192 LGGVVTLTSQSPPLWILV----------RYKDESS------------TTSQAHSTTMNPLLILTF 234

  Fly    62 --NALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYT 124
              .||.|......:||.|...:.:..|||.:|: :.|..||..::|.:|:::|.||   ...|..
Human   235 VAAALAAPFDDDDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGHC---YKSRIQ 295

  Fly   125 VRAG--STQQRRGG-QLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKR 186
            ||.|  :.:...|. |..:..|.:.||.|...|:.||:.::||.:...:...|..:.||:.....
Human   296 VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPAT 360

  Fly   187 FPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTC 249
            ..|| |.||||.|:::..:....|:.:....:|:|||:..|.|   ||...|.|.  ....:|:|
Human   361 GTKC-LISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPG---KITSNMFCVGFLEGGKDSC 421

  Fly   250 SGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            .||||||:|.||.|.|:.|:|.|||....||||..|..|.:|||
Human   422 QGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 76/223 (34%)
Tryp_SPc 74..295 CDD:238113 79/225 (35%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 76/223 (34%)
Tryp_SPc 249..467 CDD:238113 79/225 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.