DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Prss53

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:224 Identity:60/224 - (26%)
Similarity:92/224 - (41%) Gaps:21/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQLRHVQKTVCH 147
            |:.|:...|.::....||..:::...:|||.||.|   ||.|:...|.....|.:...:::.:.|
  Rat   349 SQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFI---GRQTLEEWSVGLGAGPEEWGLKQLILH 410

  Fly   148 PNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGW--GLTSANAQN----V 206
            ..|:.....:|:..:.|..|:.:|..::.:.||.. ..|.|..  ..||  |||.....|    |
  Rat   411 GAYTHPEGGHDVAFLLLAQPVTLGPGLRPLCLPYA-DHRLPDG--EHGWVLGLTREAGINHPHTV 472

  Fly   207 QRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDT-CSGDSGGPLVH----NGVLYGI 266
            ...:.|.:.|....|..    ..||:.|...|||........ |.|.||.||||    ...|.|:
  Rat   473 PVTVLGPMACSRQHAAS----GSTGVPILPGMICTTVVGEPPHCEGLSGAPLVHEIRGTWFLAGL 533

  Fly   267 TSFGIGCASAKYPGVYVNVLQYTRWIKKV 295
            .|||..|..:..|.|:..:..|..|:..:
  Rat   534 HSFGDTCQGSAKPAVFAALSAYEDWVSNL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 59/219 (27%)
Tryp_SPc 74..295 CDD:238113 60/222 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 60/221 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.