DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and Prss36

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:288 Identity:88/288 - (30%)
Similarity:127/288 - (44%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QTFLPGNI---STNPAINALEAQDYLPT----------------RIVNGKKIKCSRAPYQCALHY 93
            ||||..::   ..:|...|.:.....||                |||.|........|:|.:||:
  Rat    14 QTFLTPHLVFSVVSPTPGAFQDSAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHH 78

  Fly    94 NNYFICGCVILNRRWILTAQHCKIGN-----PGRYTVRAGSTQQ---RRGGQLRHVQKTVCHPNY 150
            ....|||..::...|:|:|.||.:.|     ...::|..|...|   ..|..:|.|...:...||
  Rat    79 GGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSVATILVPDNY 143

  Fly   151 SEYTMKNDLCMMKLKTPLNVGRCVQKVKLP--STRTKRFPKCYLASGWG-LTSANAQNVQRYLRG 212
            |...:..||.:::|.:|..:|..|:.|.||  |........|: |:||| :..::...|...|:.
  Rat   144 SRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFAHGTACW-ATGWGDVQESDPLPVPWVLQE 207

  Fly   213 VIVCKVSRAKCQQDYRGTG-----IKIYKQMICA--KRKNRDTCSGDSGGPLV-HNG---VLYGI 266
            |.:..:....||..|...|     :::...|:||  ....||||.|||||||| .:|   .|.||
  Rat   208 VELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGI 272

  Fly   267 TSFGIGCASAKYPGVYVNVLQYTRWIKK 294
            ||||.||.....|||:..|..|..||::
  Rat   273 TSFGFGCGRRNRPGVFTAVAHYESWIRE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 78/240 (33%)
Tryp_SPc 74..295 CDD:238113 79/243 (33%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 79/243 (33%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.