DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and prtn3-like.2

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_002940708.1 Gene:prtn3-like.2 / 496767 XenbaseID:XB-GENE-5764783 Length:312 Species:Xenopus tropicalis


Alignment Length:248 Identity:76/248 - (30%)
Similarity:113/248 - (45%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNP-GRYTVRAGSTQQRRG 135
            :|||.|::.:....||..:|....:..||..::|.:|:|||.||....| ....|..|:...:|.
 Frog    80 SRIVGGREARAHSRPYIASLQIRGFHFCGGALINEKWVLTAAHCMEDTPVDSVRVVLGAHNLQRP 144

  Fly   136 GQL---RHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPK--CYLASG 195
            ..|   ..||::|.:|.|:..|.:||:.::||.....:...|:.::||...:...|:  |.:| |
 Frog   145 DSLVQEFRVQESVQNPEYNPTTFQNDIHLLKLNDSAVITSGVRTIRLPVPNSDVAPRSNCSVA-G 208

  Fly   196 WG-----------LTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKN---R 246
            ||           |...||.            .:||..|.:.:.|.   |...|:||....   :
 Frog   209 WGDINDFGTSPRALMQTNAD------------IISRQACNRSWGGA---ITNTMLCAATPGVLAK 258

  Fly   247 DTCSGDSGGPLVHNGVLYGITSF-GIGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            ..||||||||||....|.|..|| |..|.:|.:|.||..|..|..||:.|.::
 Frog   259 GFCSGDSGGPLVCRNRLEGAVSFSGRFCGNAMFPDVYTRVSSYLPWIETVIRQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 73/239 (31%)
Tryp_SPc 74..295 CDD:238113 74/241 (31%)
prtn3-like.2XP_002940708.1 Tryp_SPc 81..305 CDD:214473 73/239 (31%)
Tryp_SPc 82..308 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.