DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and zgc:92590

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:246 Identity:88/246 - (35%)
Similarity:126/246 - (51%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNN-YFICGCVILNRRWILTAQHC-KIGNPGRYTV 125
            |..|.|    :|:.|.:...:..|:|..|.|:| ...||..::|.||.::|.|| .:.|  |.||
Zfish    14 ACSADD----KIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCYLVAN--RLTV 72

  Fly   126 RAG--------STQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPST 182
            ..|        .|:||     ...:|.:.||.|::||:.||..::|||.|....:.||.|.|.::
Zfish    73 HLGEHNVAVEEGTEQR-----IKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPLTTS 132

  Fly   183 RTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVC----KVSRAKCQQDYRGTGIKIYKQMICA-- 241
            .:....:| |.||||    |..|.......|:.|    .::||:|:..|   |.:|.|.|.||  
Zfish   133 CSSEGEQC-LVSGWG----NLINTGVVYPDVLQCLNLPVLTRAQCEGAY---GWQITKNMFCAGF 189

  Fly   242 KRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292
            ....:|.|.||||||::.||.|.|:.|:|.|||.:.|||||..|.:||.|:
Zfish   190 MEGGKDACQGDSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 84/234 (36%)
Tryp_SPc 74..295 CDD:238113 85/235 (36%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 84/234 (36%)
Tryp_SPc 21..243 CDD:238113 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.