DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and AgaP_AGAP010015

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_001238092.2 Gene:AgaP_AGAP010015 / 4577984 VectorBaseID:AGAP010015 Length:239 Species:Anopheles gambiae


Alignment Length:230 Identity:57/230 - (24%)
Similarity:99/230 - (43%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQ 137
            ||:||.|:...|.|:...:::.:.|:|...|:....:|:.::|......:.::..|.|....||.
Mosquito     9 RILNGLKVNPERYPFIVNIYFEDQFLCSGNIITPSHVLSLEYCFEIFVFQMSIYGGGTSPLSGGI 73

  Fly   138 LRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNV--GRC-VQKVKLPSTRTKRFPKCYLASGWGLT 199
            ...|.|...|||:.....::|..:..:..|:|.  |.. :..:.|.::......:||:. |||::
Mosquito    74 SIPVNKITIHPNFEYRYGRSDFDVAVISVPINTFQGMANMASIALQTSEVLPGSRCYVI-GWGVS 137

  Fly   200 SA-----------NAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKR-KNRDTCSGD 252
            ..           ...|:           ||::.|.:.:......:...|||||. ...|.|.||
Mosquito   138 KIFGPIDLNGLHYGTMNI-----------VSQSACSRSWASVNENVTSNMICAKYCFGVDICYGD 191

  Fly   253 SGGPLVHNGVLYGITSF-GIGCASAKYPGVYVNVL 286
            .|||||.:|.|.||..: ..|| :...|.|:..::
Mosquito   192 LGGPLVCDGKLTGIIGYTEYGC-TKNNPAVFTRIM 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 57/230 (25%)
Tryp_SPc 74..295 CDD:238113 56/229 (24%)
AgaP_AGAP010015XP_001238092.2 Tryp_SPc 9..224 CDD:214473 57/227 (25%)
Tryp_SPc 10..235 CDD:238113 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.