DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG34130

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:240 Identity:51/240 - (21%)
Similarity:98/240 - (40%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PTRIVNGKKIKCS----RAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGR---YTVRAG 128
            |.|.:|...|:.:    ..|:...:.....|:||...|:..:.||:.:|...:..:   .:|...
  Fly    37 PVRTLNKNGIRRTSGGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELV 101

  Fly   129 STQQRRGGQL-RH------VQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKR 186
            |:..|:..|| .|      ::..:...::.......|:.:::|...|. |.....|.|.:.....
  Fly   102 SSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYVTLCTNPLSS 165

  Fly   187 FPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMI-CAKRKNRDT-C 249
            :....:.| :|  :..|:||    |...:..::|..|...|   |..:.::.: |||...|.. |
  Fly   166 YKSLSVVS-YG--AGPAENV----RTEEIEVLNRMICDSAY---GNFLLRETVACAKEFKRSADC 220

  Fly   250 SGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKK 294
            ...:|.|:.....|.||.::...|..:..||::.::.|..|:|.|
  Fly   221 MFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFILK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 48/234 (21%)
Tryp_SPc 74..295 CDD:238113 49/237 (21%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 45/220 (20%)
Tryp_SPc 53..256 CDD:304450 43/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.