DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG7829

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:232 Identity:76/232 - (32%)
Similarity:108/232 - (46%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGR-YTVRAGSTQQ-RRG 135
            |||.|.....:..||..::.......||..|:|...||||.||..|.|.| ..|:.|.|.: |:.
  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKD 91

  Fly   136 GQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWGLTS 200
            |:|..|.....|.|::..||..|:.:::|...|.:.|.|:.:.:...|........:| |||..|
  Fly    92 GELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIA-GWGFKS 155

  Fly   201 ANA--QNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCSGDSGGPLVHNG 261
            .|.  .:..||.|..|   |::..|:   ...|..:..:|:||  .:...|.|..||||||....
  Fly   156 MNGPPSDSLRYARVPI---VNQTACR---NLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVRE 214

  Fly   262 VLYGITSFGIGCASAKYPGVYVNVLQYTRWIKKVAKK 298
            .|.||.|:|:|||.|..||||..:.....|:.:|..|
  Fly   215 QLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 73/224 (33%)
Tryp_SPc 74..295 CDD:238113 73/226 (32%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 73/223 (33%)
Tryp_SPc 28..248 CDD:238113 73/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.