DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and intr

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:303 Identity:65/303 - (21%)
Similarity:115/303 - (37%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VGGQSKNWSGYYVDNGTHYLL---YE-GPRIKPQTFLPGNISTNPAINALEAQDYLPTRIVNGKK 79
            ||....|...|.:.....|::   |: .|:|..:....||...| ::..:.|:  :.|.:.:|: 
  Fly    29 VGEIPSNGQPYQIVRVIEYIVPYPYQRSPKISARFSSGGNKEPN-SLEIIPAE--IETLLTDGQ- 89

  Fly    80 IKCSRAP-----YQCALHYNNYFICGCVILNRRWILTAQHC-----KIGNPGRYTVRAG-----S 129
             ..:.||     :...:.|.|..||...:::.|.:||:..|     :...|..|.::|.     |
  Fly    90 -ATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRIYS 153

  Fly   130 TQQRRGGQLRHVQKTVCH-PNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLA 193
            ......|.:..:...:.| |....:....|||...|:...||...:.:..|...|||..|     
  Fly   154 VANLITGAIEDMALLLLHAPLEDPFVHPIDLCESPLRRNDNVTMYMSQQHLRFLRTKLIP----- 213

  Fly   194 SGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNR-DTCSGDSGGPL 257
                  ::|             ||.|.|:.:..:      |.:.|:||...|| ..|....|..|
  Fly   214 ------NSN-------------CKRSYAQDENAF------ITQTMLCALNSNRLVDCQTAKGDVL 253

  Fly   258 VHNGVLYGITSFGIGCASAKYPG-VYVNVLQYTRWIKKVAKKY 299
            :|...|.|:..:|..|:.....| :|.:|.:....:..:.::|
  Fly   254 LHQDRLCGVDIYGQHCSDGGVNGELYADVFKARTELMHLIERY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 51/236 (22%)
Tryp_SPc 74..295 CDD:238113 51/238 (21%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 46/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.