DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG11836

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:231 Identity:74/231 - (32%)
Similarity:119/231 - (51%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC-KIGNPGRYTVRAGSTQQRRGG 136
            |||.||....::.|:...:.|:..|.||..:|.:.::|:|.|| |.....:..|..|...|....
  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160

  Fly   137 QLRHVQKTVC----HPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASGWG 197
            :.:.:|:.|.    |.::...|..||:.:::|:.|::..:.::.:.||........:.....|||
  Fly   161 ESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWG 225

  Fly   198 LTSANAQNVQRYLRGVIVCKVSRAKCQ-QDYRGTGIKIYKQMICAKRKNRDTCSGDSGGP-LVHN 260
            .||...: :...:..|.|..:|..:|: |.|:.|  :|...|:||.|.:.|:|.|||||| |:.|
  Fly   226 RTSEGGE-LPSIVNQVKVPIMSITECRNQRYKST--RITSSMLCAGRPSMDSCQGDSGGPLLLSN 287

  Fly   261 GVLY---GITSFGIGCASAKYPGVYVNVLQYTRWIK 293
            ||.|   ||.|:|:||....|||||..|.::..|||
  Fly   288 GVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 71/228 (31%)
Tryp_SPc 74..295 CDD:238113 73/230 (32%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.