DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32374 and CG16749

DIOPT Version :9

Sequence 1:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:235 Identity:76/235 - (32%)
Similarity:116/235 - (49%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RIVNGKKIKCSRAPYQCALH-YNNYFICGCVILNRRWILTAQHCKIGNPGR-YTVRAGSTQ-QRR 134
            |:|||......:.|:..::. .:....||..|:::::::||.||..|.... .:|:.|.|: ...
  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93

  Fly   135 GGQLRHVQKTVCHPNYSEY-TMKNDLCMMKLKTPLNV-GRCVQKVKLP-----STRTKRFPKCYL 192
            |..:..|:|.:.|.:|:.| ...||:.::.::.|... |..|..||||     :.:|....:..|
  Fly    94 GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVL 158

  Fly   193 ASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMIC--AKRKNRDTCSGDSGG 255
            . |||| :|....:|..|:.|.:...|..:|.:.:.|.....|.  ||  .....:..|||||||
  Fly   159 I-GWGL-NATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYH--ICGGVDEGGKGQCSGDSGG 219

  Fly   256 PLVHNGVLYGITSFGI-GCASAKYPGVYVNVLQYTRWIKK 294
            ||::||...||.|:.| .|..|.|||||..|.||..||||
  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 72/231 (31%)
Tryp_SPc 74..295 CDD:238113 75/234 (32%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/231 (31%)
Tryp_SPc 30..259 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.